prot_C-tenellus_contig7317.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7317.2.1 vs. uniprot
Match: D8LR68_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LR68_ECTSI) HSP 1 Score: 89.0 bits (219), Expect = 2.310e-17 Identity = 46/81 (56.79%), Postives = 60/81 (74.07%), Query Frame = 0 Query: 81 VRIEVCAHRSIEQASVLLASLSNSILLVMRRGSEGSAFRRCLLDWTVQGKIRGLCISHDLQCALCITDGL-AVYLLPIEDL 160 V IEV AH ++ ++L+ASLSNS LL++R GS+G R LLDW V GKIRG+C+S DLQC LC T+GL VYLL +++L Sbjct: 25 VGIEVFAHGALGTDALLVASLSNSALLILRIGSDG--IRSWLLDWPVAGKIRGMCVSPDLQCVLCATEGLEGVYLLAVDNL 103
BLAST of mRNA_C-tenellus_contig7317.2.1 vs. uniprot
Match: A0A6H5KV72_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KV72_9PHAE) HSP 1 Score: 86.7 bits (213), Expect = 3.970e-16 Identity = 45/81 (55.56%), Postives = 59/81 (72.84%), Query Frame = 0 Query: 81 VRIEVCAHRSIEQASVLLASLSNSILLVMRRGSEGSAFRRCLLDWTVQGKIRGLCISHDLQCALCITDGL-AVYLLPIEDL 160 V IEV AH ++ ++L+ASLSNS LL++R GS+ R LLDW V GKIRG+C+S DLQC LC T+GL VYLL +++L Sbjct: 25 VGIEVFAHGALGTDALLVASLSNSALLILRIGSD--CIRSWLLDWPVAGKIRGMCVSPDLQCVLCATEGLEGVYLLAVDNL 103 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7317.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7317.2.1 ID=prot_C-tenellus_contig7317.2.1|Name=mRNA_C-tenellus_contig7317.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=208bpback to top |