mRNA_C-tenellus_contig7274.3.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7274.3.1 vs. uniprot
Match: A0A6U3ULQ3_9STRA (T-complex protein 1 subunit epsilon n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A6U3ULQ3_9STRA) HSP 1 Score: 82.0 bits (201), Expect = 5.750e-17 Identity = 40/43 (93.02%), Postives = 43/43 (100.00%), Query Frame = 1 Query: 25 QSNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTITNDGATI 153 +SNILAARS+SNILR+SLGPKGMDKMLVSPDGDVTITNDGATI Sbjct: 31 KSNILAARSISNILRTSLGPKGMDKMLVSPDGDVTITNDGATI 73
BLAST of mRNA_C-tenellus_contig7274.3.1 vs. uniprot
Match: A0A2A2M0N7_9BILA (Uncharacterized protein n=1 Tax=Diploscapter pachys TaxID=2018661 RepID=A0A2A2M0N7_9BILA) HSP 1 Score: 76.6 bits (187), Expect = 7.010e-17 Identity = 37/43 (86.05%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 25 QSNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTITNDGATI 153 +S+ILAARSVSN LRSSLGP+G+DKM+VSPDGDVTITNDGATI Sbjct: 35 KSHILAARSVSNTLRSSLGPRGLDKMIVSPDGDVTITNDGATI 77
BLAST of mRNA_C-tenellus_contig7274.3.1 vs. uniprot
Match: D7FI32_ECTSI (T-complex protein 1 subunit epsilon n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FI32_ECTSI) HSP 1 Score: 80.9 bits (198), Expect = 1.470e-16 Identity = 40/43 (93.02%), Postives = 43/43 (100.00%), Query Frame = 1 Query: 25 QSNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTITNDGATI 153 ++NILAARSVSNILRSSLGPKGMDKMLVSPDGDVTI+NDGATI Sbjct: 31 KTNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTISNDGATI 73
BLAST of mRNA_C-tenellus_contig7274.3.1 vs. uniprot
Match: A0A7S0SVM0_9STRA (Hypothetical protein (Fragment) n=1 Tax=Chromulina nebulosa TaxID=96789 RepID=A0A7S0SVM0_9STRA) HSP 1 Score: 77.8 bits (190), Expect = 1.810e-16 Identity = 38/43 (88.37%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 25 QSNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTITNDGATI 153 +SNI+AARSVSN+LR+SLGPKGMDKMLVS DGDVTITNDGATI Sbjct: 31 KSNIMAARSVSNLLRTSLGPKGMDKMLVSSDGDVTITNDGATI 73
BLAST of mRNA_C-tenellus_contig7274.3.1 vs. uniprot
Match: B7G2T8_PHATC (T-complex protein 1 subunit epsilon n=1 Tax=Phaeodactylum tricornutum (strain CCAP 1055/1) TaxID=556484 RepID=B7G2T8_PHATC) HSP 1 Score: 79.7 bits (195), Expect = 3.750e-16 Identity = 38/43 (88.37%), Postives = 43/43 (100.00%), Query Frame = 1 Query: 25 QSNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTITNDGATI 153 +SNILAARS+SN+LR+SLGPKG+DKMLVSPDGDVTITNDGATI Sbjct: 31 KSNILAARSISNMLRTSLGPKGLDKMLVSPDGDVTITNDGATI 73
BLAST of mRNA_C-tenellus_contig7274.3.1 vs. uniprot
Match: A0A1E7FRJ6_9STRA (T-complex protein 1 subunit epsilon n=3 Tax=Bacillariaceae TaxID=33852 RepID=A0A1E7FRJ6_9STRA) HSP 1 Score: 79.7 bits (195), Expect = 3.760e-16 Identity = 38/43 (88.37%), Postives = 43/43 (100.00%), Query Frame = 1 Query: 25 QSNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTITNDGATI 153 ++NILAARS+SNILR+SLGPKGMDK+LVSPDGDVTITNDGATI Sbjct: 31 KANILAARSISNILRTSLGPKGMDKLLVSPDGDVTITNDGATI 73
BLAST of mRNA_C-tenellus_contig7274.3.1 vs. uniprot
Match: A0A835ZI55_9STRA (T-complex protein 1 subunit epsilon n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZI55_9STRA) HSP 1 Score: 79.0 bits (193), Expect = 7.000e-16 Identity = 38/43 (88.37%), Postives = 43/43 (100.00%), Query Frame = 1 Query: 25 QSNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTITNDGATI 153 +SNILAARSVS++LR+SLGPKGMDKM+VSPDGDVTITNDGATI Sbjct: 32 KSNILAARSVSSLLRTSLGPKGMDKMMVSPDGDVTITNDGATI 74
BLAST of mRNA_C-tenellus_contig7274.3.1 vs. uniprot
Match: A0A7S2SPL3_9STRA (Hypothetical protein (Fragment) n=2 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SPL3_9STRA) HSP 1 Score: 75.1 bits (183), Expect = 7.330e-16 Identity = 38/43 (88.37%), Postives = 40/43 (93.02%), Query Frame = 1 Query: 25 QSNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTITNDGATI 153 +SNILAARSVSNILR+SLGPKGMDKMLV DG VTITNDGATI Sbjct: 60 KSNILAARSVSNILRTSLGPKGMDKMLVDQDGGVTITNDGATI 102
BLAST of mRNA_C-tenellus_contig7274.3.1 vs. uniprot
Match: A0A261BK46_9PELO (Uncharacterized protein (Fragment) n=3 Tax=Caenorhabditis TaxID=6237 RepID=A0A261BK46_9PELO) HSP 1 Score: 73.9 bits (180), Expect = 9.180e-16 Identity = 35/43 (81.40%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 25 QSNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTITNDGATI 153 +S+ILAAR+V+N LR+SLGP+G+DKMLVSPDGDVTITNDGATI Sbjct: 36 KSHILAARAVANTLRTSLGPRGLDKMLVSPDGDVTITNDGATI 78
BLAST of mRNA_C-tenellus_contig7274.3.1 vs. uniprot
Match: A0A7S3PR08_9STRA (T-complex protein 1 subunit epsilon n=3 Tax=Aplanochytrium stocchinoi TaxID=215587 RepID=A0A7S3PR08_9STRA) HSP 1 Score: 78.6 bits (192), Expect = 9.560e-16 Identity = 38/43 (88.37%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 25 QSNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTITNDGATI 153 ++NILAAR+VS +LRSSLGPKGMDKMLVSPDGDVTITNDGATI Sbjct: 31 KANILAARTVSGVLRSSLGPKGMDKMLVSPDGDVTITNDGATI 73 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7274.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig7274.3.1 >prot_C-tenellus_contig7274.3.1 ID=prot_C-tenellus_contig7274.3.1|Name=mRNA_C-tenellus_contig7274.3.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=51bp MLVCAILFQSNILAARSVSNILRSSLGPKGMDKMLVSPDGDVTITNDGATback to top mRNA from alignment at C-tenellus_contig7274:4809..4961+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig7274.3.1 ID=mRNA_C-tenellus_contig7274.3.1|Name=mRNA_C-tenellus_contig7274.3.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=153bp|location=Sequence derived from alignment at C-tenellus_contig7274:4809..4961+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig7274:4809..4961+ >mRNA_C-tenellus_contig7274.3.1 ID=mRNA_C-tenellus_contig7274.3.1|Name=mRNA_C-tenellus_contig7274.3.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=153bp|location=Sequence derived from alignment at C-tenellus_contig7274:4809..4961+ (Choristocarpus tenellus KU2346)back to top |