prot_C-tenellus_contig6874.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig6874.1.1 vs. uniprot
Match: A0A6H5L473_9PHAE (AAA_11 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L473_9PHAE) HSP 1 Score: 72.8 bits (177), Expect = 7.950e-14 Identity = 31/45 (68.89%), Postives = 38/45 (84.44%), Query Frame = 0 Query: 1 MNTWTTHDLSAAGYAVHGLVGARIGKLFQEHVVRFSLSPRRADNK 45 M +WT H+LS+ GY V GLVGAR+G+LF+EHVVRFSL PRR DN+ Sbjct: 1 MTSWTQHELSSGGYTVQGLVGARVGRLFREHVVRFSLPPRRGDNR 45
BLAST of mRNA_C-tenellus_contig6874.1.1 vs. uniprot
Match: D7FK70_ECTSI (tRNA-splicing endonuclease positive effector n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FK70_ECTSI) HSP 1 Score: 72.4 bits (176), Expect = 1.080e-13 Identity = 31/45 (68.89%), Postives = 38/45 (84.44%), Query Frame = 0 Query: 1 MNTWTTHDLSAAGYAVHGLVGARIGKLFQEHVVRFSLSPRRADNK 45 M +WT H+LS+ GY V GLVGAR+G+LF+EHVVRFSL PRR DN+ Sbjct: 14 MTSWTQHELSSGGYTVQGLVGARVGRLFREHVVRFSLPPRRRDNR 58 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig6874.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig6874.1.1 ID=prot_C-tenellus_contig6874.1.1|Name=mRNA_C-tenellus_contig6874.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=45bpback to top |