prot_C-tenellus_contig6568.4.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig6568.4.1 vs. uniprot
Match: A0A6H5JPL9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPL9_9PHAE) HSP 1 Score: 73.2 bits (178), Expect = 2.240e-12 Identity = 31/44 (70.45%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 94 EHLVKKVVQLNHLAVYWNPAEAGNPCSIHVSDLPVEEAEVVICR 137 + LVKK +QLN LAVYWNPAE+GNPCS+ +SD+PV++AEVVI R Sbjct: 262 DRLVKKTLQLNQLAVYWNPAESGNPCSMDLSDIPVDQAEVVISR 305
BLAST of mRNA_C-tenellus_contig6568.4.1 vs. uniprot
Match: D8LP20_ECTSI (Vacuolar protein sorting-associated protein, putative n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LP20_ECTSI) HSP 1 Score: 73.2 bits (178), Expect = 2.350e-12 Identity = 31/44 (70.45%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 94 EHLVKKVVQLNHLAVYWNPAEAGNPCSIHVSDLPVEEAEVVICR 137 + LVKK +QLN LAVYWNPAE+GNPCS+ +SD+PV++AEVVI R Sbjct: 301 DRLVKKTLQLNQLAVYWNPAESGNPCSMDLSDIPVDQAEVVISR 344 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig6568.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig6568.4.1 ID=prot_C-tenellus_contig6568.4.1|Name=mRNA_C-tenellus_contig6568.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=138bpback to top |