mRNA_C-tenellus_contig11482.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig11482.2.1 vs. uniprot
Match: A0A8K1IYZ2_9RICK (MFS transporter n=1 Tax=Rickettsia endosymbiont of Cimex lectularius TaxID=2698648 RepID=A0A8K1IYZ2_9RICK) HSP 1 Score: 63.9 bits (154), Expect = 1.530e-10 Identity = 33/41 (80.49%), Postives = 36/41 (87.80%), Query Frame = 1 Query: 10 ISFKKALFLWSLASIFLAFQFILRLSTGILREEITQKFAID 132 +S KK L LWSLA++F AFQFILRLSTGILREEI QKFAID Sbjct: 5 LSLKKPLLLWSLATLFFAFQFILRLSTGILREEIIQKFAID 45
BLAST of mRNA_C-tenellus_contig11482.2.1 vs. uniprot
Match: A0A261DAB6_9RICK (MFS domain-containing protein n=3 Tax=unclassified Rickettsia TaxID=114295 RepID=A0A261DAB6_9RICK) HSP 1 Score: 63.2 bits (152), Expect = 2.870e-10 Identity = 33/41 (80.49%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 10 ISFKKALFLWSLASIFLAFQFILRLSTGILREEITQKFAID 132 +S KK LWSLAS+F AFQFILRLSTGILREEI QKFAID Sbjct: 5 LSLKKPFLLWSLASMFFAFQFILRLSTGILREEIMQKFAID 45
BLAST of mRNA_C-tenellus_contig11482.2.1 vs. uniprot
Match: A0A3S0AV35_9RICK (MFS transporter n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A3S0AV35_9RICK) HSP 1 Score: 58.2 bits (139), Expect = 1.680e-8 Identity = 28/46 (60.87%), Postives = 36/46 (78.26%), Query Frame = 1 Query: 1 MSNISFKKALFLWSLASIFLAFQFILRLSTGILREEITQKFAIDAA 138 M N + K + +WSLA++F A+QFILRLS GILRE+I QKFA+D A Sbjct: 1 MVNSPYSKPVLIWSLANLFFAYQFILRLSAGILREQIMQKFAVDCA 46
BLAST of mRNA_C-tenellus_contig11482.2.1 vs. uniprot
Match: A0A2A5BDN7_9RICK (MFS domain-containing protein n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A2A5BDN7_9RICK) HSP 1 Score: 57.0 bits (136), Expect = 4.310e-8 Identity = 28/46 (60.87%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 1 MSNISFKKALFLWSLASIFLAFQFILRLSTGILREEITQKFAIDAA 138 M+NIS KK++ L SLA++F FQFILRLS G+ RE+I Q+FA+D A Sbjct: 1 MNNISLKKSILLLSLANLFFFFQFILRLSAGVFREDIMQRFAVDVA 46
BLAST of mRNA_C-tenellus_contig11482.2.1 vs. uniprot
Match: A0A7V9T321_9RICK (MFS transporter (Fragment) n=1 Tax=Rickettsiaceae bacterium TaxID=2023360 RepID=A0A7V9T321_9RICK) HSP 1 Score: 56.2 bits (134), Expect = 6.440e-8 Identity = 28/40 (70.00%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 19 KKALFLWSLASIFLAFQFILRLSTGILREEITQKFAIDAA 138 KK L LW LA++F AFQFILRLS GILRE+I QKF++DA+ Sbjct: 7 KKYLALWCLANLFFAFQFILRLSAGILREDIIQKFSVDAS 46
BLAST of mRNA_C-tenellus_contig11482.2.1 vs. uniprot
Match: A0A4Q3DJ34_9RICK (MFS transporter n=1 Tax=Rickettsiaceae bacterium TaxID=2023360 RepID=A0A4Q3DJ34_9RICK) HSP 1 Score: 52.8 bits (125), Expect = 1.350e-6 Identity = 26/39 (66.67%), Postives = 31/39 (79.49%), Query Frame = 1 Query: 22 KALFLWSLASIFLAFQFILRLSTGILREEITQKFAIDAA 138 K L LW+ ++F AFQFILRLS GILRE+I Q+FAID A Sbjct: 5 KPLVLWTFCTLFFAFQFILRLSVGILREDIIQRFAIDTA 43 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig11482.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig11482.2.1 >prot_C-tenellus_contig11482.2.1 ID=prot_C-tenellus_contig11482.2.1|Name=mRNA_C-tenellus_contig11482.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=54bp MSNISFKKALFLWSLASIFLAFQFILRLSTGILREEITQKFAIDAACLRSback to top mRNA from alignment at C-tenellus_contig11482:5043..5204+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig11482.2.1 ID=mRNA_C-tenellus_contig11482.2.1|Name=mRNA_C-tenellus_contig11482.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=162bp|location=Sequence derived from alignment at C-tenellus_contig11482:5043..5204+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig11482:5043..5204+ >mRNA_C-tenellus_contig11482.2.1 ID=mRNA_C-tenellus_contig11482.2.1|Name=mRNA_C-tenellus_contig11482.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=162bp|location=Sequence derived from alignment at C-tenellus_contig11482:5043..5204+ (Choristocarpus tenellus KU2346)back to top |