prot_C-tenellus_contig9991.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9991.2.1 vs. uniprot
Match: D7FTV9_ECTSI (RGS domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTV9_ECTSI) HSP 1 Score: 47.8 bits (112), Expect = 1.270e-5 Identity = 19/35 (54.29%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 2 FEQLISTPYMTEAFEEFARKALCQESMLFMNEVSR 36 FE++ STP + AFE+++++ALC ES+LF++EVSR Sbjct: 6 FERIASTPLLAAAFEDYSKRALCHESVLFLSEVSR 40
BLAST of mRNA_C-tenellus_contig9991.2.1 vs. uniprot
Match: D7FTW1_ECTSI (RGS domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTW1_ECTSI) HSP 1 Score: 47.8 bits (112), Expect = 3.720e-5 Identity = 19/35 (54.29%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 2 FEQLISTPYMTEAFEEFARKALCQESMLFMNEVSR 36 FE++ STP + AFE+++++ALC ES+LF++EVSR Sbjct: 342 FERIASTPLLAAAFEDYSKRALCHESVLFLSEVSR 376
BLAST of mRNA_C-tenellus_contig9991.2.1 vs. uniprot
Match: D7G2T5_ECTSI (RGS domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2T5_ECTSI) HSP 1 Score: 46.6 bits (109), Expect = 9.350e-5 Identity = 19/35 (54.29%), Postives = 29/35 (82.86%), Query Frame = 0 Query: 2 FEQLISTPYMTEAFEEFARKALCQESMLFMNEVSR 36 FE+L TP + AFE+++++ALC ES+LF++EVSR Sbjct: 122 FERLARTPLLAAAFEDYSKRALCHESVLFLSEVSR 156 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9991.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9991.2.1 ID=prot_C-tenellus_contig9991.2.1|Name=mRNA_C-tenellus_contig9991.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=37bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|