prot_C-tenellus_contig9984.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9984.2.1 vs. uniprot
Match: D7FJY6_ECTSI (Hydrocephalus-inducing protein, Hydin-like protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FJY6_ECTSI) HSP 1 Score: 62.4 bits (150), Expect = 4.000e-10 Identity = 25/35 (71.43%), Postives = 34/35 (97.14%), Query Frame = 0 Query: 1 LLATTLKVYEFYLTVDIDGVGEELLSLPIKADCQV 35 L++ T+KVYE+Y+TVD++GVGEELLS+P+KADCQV Sbjct: 755 LMSQTVKVYEYYITVDVEGVGEELLSIPLKADCQV 789
BLAST of mRNA_C-tenellus_contig9984.2.1 vs. uniprot
Match: A0A6H5K5Z3_9PHAE (MSP domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K5Z3_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 1.710e-8 Identity = 23/30 (76.67%), Postives = 30/30 (100.00%), Query Frame = 0 Query: 6 LKVYEFYLTVDIDGVGEELLSLPIKADCQV 35 L+VYE+Y+TVD++GVGEELLS+P+KADCQV Sbjct: 708 LQVYEYYITVDVEGVGEELLSIPLKADCQV 737
BLAST of mRNA_C-tenellus_contig9984.2.1 vs. uniprot
Match: A0A7S2QVW6_9STRA (Hypothetical protein n=2 Tax=Triparma pacifica TaxID=91992 RepID=A0A7S2QVW6_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 2.860e-7 Identity = 24/35 (68.57%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 1 LLATTLKVYEFYLTVDIDGVGEELLSLPIKADCQV 35 L++TT+K YE+ L VDI+GVGE LLSLPI ADC+V Sbjct: 39 LISTTVKTYEYSLVVDIEGVGENLLSLPILADCKV 73
BLAST of mRNA_C-tenellus_contig9984.2.1 vs. uniprot
Match: UPI0009E5E06D (LOW QUALITY PROTEIN: hydrocephalus-inducing protein homolog n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E5E06D) HSP 1 Score: 50.4 bits (119), Expect = 6.560e-6 Identity = 27/50 (54.00%), Postives = 32/50 (64.00%), Query Frame = 0 Query: 2 LATTLKVYEFYLTVDIDGVGEELLSLPIKADCQVT-------IPDYFLCF 44 ++TT+K YE L VD+DGVGEE+LSLPI A C V I DY CF Sbjct: 704 VSTTVKKYEIALVVDVDGVGEEILSLPIIAKCVVPPITVSTPILDYGRCF 753
BLAST of mRNA_C-tenellus_contig9984.2.1 vs. uniprot
Match: UPI0003F0D05C (hydrocephalus-inducing protein homolog n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F0D05C) HSP 1 Score: 50.1 bits (118), Expect = 8.980e-6 Identity = 26/51 (50.98%), Postives = 32/51 (62.75%), Query Frame = 0 Query: 1 LLATTLKVYEFYLTVDIDGVGEELLSLPIKADCQVT-------IPDYFLCF 44 L++ T+K Y+ + VDIDGVGEE+LSLPI A C V I DY CF Sbjct: 652 LISNTIKKYDMSVVVDIDGVGEEILSLPISAKCVVPAIAVVTPILDYKRCF 702
BLAST of mRNA_C-tenellus_contig9984.2.1 vs. uniprot
Match: A0A2B4RXX1_STYPI (Hydrocephalus-inducing protein n=3 Tax=Pocilloporidae TaxID=46729 RepID=A0A2B4RXX1_STYPI) HSP 1 Score: 49.7 bits (117), Expect = 1.230e-5 Identity = 26/50 (52.00%), Postives = 32/50 (64.00%), Query Frame = 0 Query: 2 LATTLKVYEFYLTVDIDGVGEELLSLPIKADCQVT-------IPDYFLCF 44 ++TT+K YE L VD+DGVGEE+LSLPI A C V + DY CF Sbjct: 667 VSTTVKKYEITLVVDVDGVGEEILSLPIIAKCVVPPITVSTPLLDYGRCF 716
BLAST of mRNA_C-tenellus_contig9984.2.1 vs. uniprot
Match: A0A8J2SKS6_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2SKS6_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 1.680e-5 Identity = 19/31 (61.29%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 5 TLKVYEFYLTVDIDGVGEELLSLPIKADCQV 35 T+KVY+FY+ VD+ VGE LLSLP++A+C+V Sbjct: 608 TIKVYDFYIVVDVPNVGEALLSLPVQAECKV 638
BLAST of mRNA_C-tenellus_contig9984.2.1 vs. uniprot
Match: A0A7M7ND56_STRPU (Hydin_ADK domain-containing protein n=5 Tax=Echinacea TaxID=7674 RepID=A0A7M7ND56_STRPU) HSP 1 Score: 48.9 bits (115), Expect = 2.300e-5 Identity = 26/51 (50.98%), Postives = 31/51 (60.78%), Query Frame = 0 Query: 1 LLATTLKVYEFYLTVDIDGVGEELLSLPIKADCQVT-------IPDYFLCF 44 L + +LK Y+ L VD+DGVG+ELLSLPI A C V I DY CF Sbjct: 652 LTSNSLKKYDLALVVDVDGVGQELLSLPISAKCVVPSISVVTPILDYTRCF 702
BLAST of mRNA_C-tenellus_contig9984.2.1 vs. uniprot
Match: F0Y448_AURAN (Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y448_AURAN) HSP 1 Score: 48.5 bits (114), Expect = 3.150e-5 Identity = 21/35 (60.00%), Postives = 27/35 (77.14%), Query Frame = 0 Query: 1 LLATTLKVYEFYLTVDIDGVGEELLSLPIKADCQV 35 L ++KVY+FYL VD+ GVG+ LLSLPI A+C V Sbjct: 621 LTPMSVKVYDFYLVVDVPGVGDALLSLPISAECLV 655
BLAST of mRNA_C-tenellus_contig9984.2.1 vs. uniprot
Match: UPI00077AF324 (LOW QUALITY PROTEIN: hydrocephalus-inducing protein homolog n=2 Tax=Acropora TaxID=6127 RepID=UPI00077AF324) HSP 1 Score: 48.5 bits (114), Expect = 3.150e-5 Identity = 25/50 (50.00%), Postives = 32/50 (64.00%), Query Frame = 0 Query: 2 LATTLKVYEFYLTVDIDGVGEELLSLPIKADCQVT-------IPDYFLCF 44 ++TT+K YE L VD+DGVG+E+LSLPI A C V + DY CF Sbjct: 667 VSTTVKKYEVALVVDVDGVGDEILSLPIVAKCVVPPITISTPLLDYGRCF 716 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9984.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 11
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9984.2.1 ID=prot_C-tenellus_contig9984.2.1|Name=mRNA_C-tenellus_contig9984.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=47bpback to top |