prot_C-tenellus_contig9981.4.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9981.4.1 vs. uniprot
Match: A0A1R2BFE9_9CILI (Uncharacterized protein n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2BFE9_9CILI) HSP 1 Score: 52.8 bits (125), Expect = 1.100e-6 Identity = 23/43 (53.49%), Postives = 30/43 (69.77%), Query Frame = 0 Query: 8 WIVIAGYLKQRFPVNPRSAKQCCERLYHHLDPEVSKNEWTADE 50 W +IA L R+ + R+AKQC ER ++HLDPEV KN W A+E Sbjct: 29 WTLIAKMLVTRYNIRGRTAKQCRERWHNHLDPEVVKNYWDAEE 71
BLAST of mRNA_C-tenellus_contig9981.4.1 vs. uniprot
Match: G0R0C8_ICHMG (Myb-like DNA-binding domain protein n=1 Tax=Ichthyophthirius multifiliis (strain G5) TaxID=857967 RepID=G0R0C8_ICHMG) HSP 1 Score: 51.2 bits (121), Expect = 2.320e-6 Identity = 18/43 (41.86%), Postives = 32/43 (74.42%), Query Frame = 0 Query: 8 WIVIAGYLKQRFPVNPRSAKQCCERLYHHLDPEVSKNEWTADE 50 W +IA + +++ ++ R+ KQC ER ++HLDP+++K +W ADE Sbjct: 27 WSLIAQKMSEQYNISNRTGKQCRERWHNHLDPQINKEQWAADE 69
BLAST of mRNA_C-tenellus_contig9981.4.1 vs. uniprot
Match: A0A1R2BLU1_9CILI (Uncharacterized protein n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2BLU1_9CILI) HSP 1 Score: 51.2 bits (121), Expect = 3.900e-6 Identity = 21/43 (48.84%), Postives = 30/43 (69.77%), Query Frame = 0 Query: 8 WIVIAGYLKQRFPVNPRSAKQCCERLYHHLDPEVSKNEWTADE 50 W +IA L R+ + R+AKQC ER ++HLDP++ KN W A+E Sbjct: 29 WTLIAKILVTRYNIRGRTAKQCRERWHNHLDPDIVKNYWDAEE 71
BLAST of mRNA_C-tenellus_contig9981.4.1 vs. uniprot
Match: A4S269_OSTLU (Uncharacterized protein (Fragment) n=1 Tax=Ostreococcus lucimarinus (strain CCE9901) TaxID=436017 RepID=A4S269_OSTLU) HSP 1 Score: 48.1 bits (113), Expect = 2.830e-5 Identity = 25/52 (48.08%), Postives = 31/52 (59.62%), Query Frame = 0 Query: 1 MCTELAS--WIVIAGYLKQRFPVNPRSAKQCCERLYHHLDPEVSKNEWTADE 50 + TEL + W IAG L R KQC ER Y+HLDPE+ + EW+ADE Sbjct: 86 LVTELGAKRWSKIAGELPGRI------GKQCRERWYNHLDPEIKREEWSADE 131
BLAST of mRNA_C-tenellus_contig9981.4.1 vs. uniprot
Match: A0A0G4GVP2_VITBC (Uncharacterized protein n=2 Tax=Vitrella brassicaformis TaxID=1169539 RepID=A0A0G4GVP2_VITBC) HSP 1 Score: 47.8 bits (112), Expect = 6.730e-5 Identity = 21/43 (48.84%), Postives = 29/43 (67.44%), Query Frame = 0 Query: 8 WIVIAGYLKQRFPVNPRSAKQCCERLYHHLDPEVSKNEWTADE 50 W I+ LK+R V+ R KQC ER Y+H+DP + + EWTA+E Sbjct: 58 WTEISRTLKERLGVD-RLGKQCRERWYNHVDPNIKRGEWTAEE 99
BLAST of mRNA_C-tenellus_contig9981.4.1 vs. uniprot
Match: A0A444URJ1_ACIRT (Myb-related protein B n=1 Tax=Acipenser ruthenus TaxID=7906 RepID=A0A444URJ1_ACIRT) HSP 1 Score: 46.2 bits (108), Expect = 8.050e-5 Identity = 22/49 (44.90%), Postives = 28/49 (57.14%), Query Frame = 0 Query: 2 CTELASWIVIAGYLKQRFPVNPRSAKQCCERLYHHLDPEVSKNEWTADE 50 C W IA +LK R KQC ER ++HL+PEV K+ WTA+E Sbjct: 63 CYGTKQWATIAKHLKGRL------GKQCRERWHNHLNPEVKKSSWTAEE 105
BLAST of mRNA_C-tenellus_contig9981.4.1 vs. uniprot
Match: A0A7S0E961_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Phaeocystis antarctica TaxID=33657 RepID=A0A7S0E961_9EUKA) HSP 1 Score: 45.4 bits (106), Expect = 9.220e-5 Identity = 21/43 (48.84%), Postives = 25/43 (58.14%), Query Frame = 0 Query: 8 WIVIAGYLKQRFPVNPRSAKQCCERLYHHLDPEVSKNEWTADE 50 W +AGYL R KQC ER ++HL P+V K WTADE Sbjct: 21 WSTVAGYLPGRM------GKQCRERWFNHLCPDVKKGSWTADE 57 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9981.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9981.4.1 ID=prot_C-tenellus_contig9981.4.1|Name=mRNA_C-tenellus_contig9981.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=50bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|