prot_C-tenellus_contig9184.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9184.1.1 vs. uniprot
Match: D8LHY3_ECTSI (EsV-1-7 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LHY3_ECTSI) HSP 1 Score: 50.8 bits (120), Expect = 2.980e-5 Identity = 24/42 (57.14%), Postives = 28/42 (66.67%), Query Frame = 0 Query: 1 MRKSCQWEGCSKPAYYAPPGLTKAVACALHKGTMFVNVHNKI 42 MRK+C E C + AYY PG K V CALHK +VNVHNK+ Sbjct: 1 MRKACGEENCDRHAYYGLPG-GKPVFCALHKDVGYVNVHNKM 41
BLAST of mRNA_C-tenellus_contig9184.1.1 vs. uniprot
Match: A0A6H5JFE0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFE0_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 8.740e-5 Identity = 24/42 (57.14%), Postives = 28/42 (66.67%), Query Frame = 0 Query: 1 MRKSCQWEGCSKPAYYAPPGLTKAVACALHKGTMFVNVHNKI 42 MRK+C E C + AYY PG K V CALHK +VNVHNK+ Sbjct: 1 MRKACGEENCDRHAYYGLPG-GKPVFCALHKDVGYVNVHNKM 41 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9184.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig9184.1.1 ID=prot_C-tenellus_contig9184.1.1|Name=mRNA_C-tenellus_contig9184.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=124bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|