prot_C-tenellus_contig8787.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig8787.1.1 vs. uniprot
Match: D8LQ98_ECTSI (Cilia- and flagella-associated protein 53 n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LQ98_ECTSI) HSP 1 Score: 75.1 bits (183), Expect = 1.500e-14 Identity = 32/43 (74.42%), Postives = 39/43 (90.70%), Query Frame = 0 Query: 3 RRQYVQQCYNRQWRDACDEARALDSKATVDWVTSKRWQQVAEK 45 RR YVQ+CY+RQWRDACD+AR LDSKA +WVT++RW+QVAEK Sbjct: 126 RRNYVQECYDRQWRDACDDARTLDSKANTEWVTAQRWEQVAEK 168
BLAST of mRNA_C-tenellus_contig8787.1.1 vs. uniprot
Match: A0A835YTH0_9STRA (Cilia- and flagella-associated protein 53 n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YTH0_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 3.630e-8 Identity = 25/43 (58.14%), Postives = 35/43 (81.40%), Query Frame = 0 Query: 3 RRQYVQQCYNRQWRDACDEARALDSKATVDWVTSKRWQQVAEK 45 R+Q+VQ Y++QWRD+CD +R LDSKA +DWV ++R QQ+ EK Sbjct: 127 RKQFVQDMYDKQWRDSCDASRTLDSKAFLDWVNAQREQQLEEK 169
BLAST of mRNA_C-tenellus_contig8787.1.1 vs. uniprot
Match: A0A7S3YAB2_HETAK (Cilia- and flagella-associated protein 53 n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3YAB2_HETAK) HSP 1 Score: 55.1 bits (131), Expect = 1.740e-7 Identity = 26/47 (55.32%), Postives = 38/47 (80.85%), Query Frame = 0 Query: 3 RRQYVQQCYNRQWRDACDEARALDSKATVDWVTSKRWQQVAEKERQK 49 R+ +VQ Y+R+WRDACD+ARALDS+A +D+V +R Q++EK R+K Sbjct: 123 RQAFVQDAYDRRWRDACDDARALDSQALLDFVAQERLSQLSEKGRRK 169
BLAST of mRNA_C-tenellus_contig8787.1.1 vs. uniprot
Match: B8BRA0_THAPS (Uncharacterized protein n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B8BRA0_THAPS) HSP 1 Score: 48.5 bits (114), Expect = 3.580e-5 Identity = 21/43 (48.84%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 3 RRQYVQQCYNRQWRDACDEARALDSKATVDWVTSKRWQQVAEK 45 R+++V++CY R+WR+ACD+ RALDSKAT+D + R + +K Sbjct: 118 RQKFVKECYERRWREACDDLRALDSKATLDRLMKDRKAMIQKK 160 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig8787.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig8787.1.1 ID=prot_C-tenellus_contig8787.1.1|Name=mRNA_C-tenellus_contig8787.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=50bpback to top |