prot_C-tenellus_contig8392.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig8392.2.1 vs. uniprot
Match: D8LE86_ECTSI (Similar to Transmembrane protein 15 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LE86_ECTSI) HSP 1 Score: 80.9 bits (198), Expect = 1.170e-12 Identity = 40/80 (50.00%), Postives = 59/80 (73.75%), Query Frame = 0 Query: 138 GGEIIYIARGVKEGAVGLLRDPVRGGQEEGVRGFAKGLGTGVFGVVGRPVRGIFRAGGNTCIGLR----NSAYIVLGASR 213 GGE+++IA GV + AVG++RDPVRG Q +G RG +G+G+GVFGVV +PV+G+ +AG N G+R + +V+G+SR Sbjct: 104 GGEVLFIAEGVAQAAVGIIRDPVRGAQADGARGLVRGIGSGVFGVVLKPVKGVAKAGVNAYTGVRIGVSKAGRVVVGSSR 183
BLAST of mRNA_C-tenellus_contig8392.2.1 vs. uniprot
Match: A0A6H5L8T3_9PHAE (Dolichol kinase n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L8T3_9PHAE) HSP 1 Score: 77.0 bits (188), Expect = 2.160e-11 Identity = 39/80 (48.75%), Postives = 58/80 (72.50%), Query Frame = 0 Query: 138 GGEIIYIARGVKEGAVGLLRDPVRGGQEEGVRGFAKGLGTGVFGVVGRPVRGIFRAGGNTCIGLR----NSAYIVLGASR 213 GGE+++IA GV + A+G++RDPVRG Q +G RG +GLG+GV GVV +PV+G+ +AG N G+R + +V+G+SR Sbjct: 253 GGEVLFIAEGVAQAALGVIRDPVRGAQADGARGLVRGLGSGVAGVVLKPVKGVAKAGVNAYTGVRIGVSKAGRVVVGSSR 332 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig8392.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig8392.2.1 ID=prot_C-tenellus_contig8392.2.1|Name=mRNA_C-tenellus_contig8392.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=409bpback to top |