prot_C-tenellus_contig8316.4.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig8316.4.1 vs. uniprot
Match: D8LS70_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LS70_ECTSI) HSP 1 Score: 85.1 bits (209), Expect = 6.500e-14 Identity = 35/59 (59.32%), Postives = 42/59 (71.19%), Query Frame = 0 Query: 292 GRVDWTQVGKGAAGFVLGFACFTVQGSDWARASYYLWHSAWHVLAMGSTLPLIRARRWG 350 G +DW Q+G G AGF G CF VQG+ Y+LWH AWHVLAMGS +P++RARRWG Sbjct: 1104 GLLDWRQLGLGVAGFAAGLTCFAVQGTSATAGWYHLWHGAWHVLAMGSAVPILRARRWG 1162
BLAST of mRNA_C-tenellus_contig8316.4.1 vs. uniprot
Match: A0A6H5JJD0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJD0_9PHAE) HSP 1 Score: 85.1 bits (209), Expect = 7.100e-14 Identity = 35/59 (59.32%), Postives = 42/59 (71.19%), Query Frame = 0 Query: 292 GRVDWTQVGKGAAGFVLGFACFTVQGSDWARASYYLWHSAWHVLAMGSTLPLIRARRWG 350 G +DW Q+G G AGF G CF VQG+ Y+LWH AWHVLAMGS +P++RARRWG Sbjct: 1687 GLLDWRQLGLGVAGFAAGLTCFAVQGTSATAGWYHLWHGAWHVLAMGSAVPILRARRWG 1745 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig8316.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig8316.4.1 ID=prot_C-tenellus_contig8316.4.1|Name=mRNA_C-tenellus_contig8316.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=424bpback to top |