prot_C-tenellus_contig831.4.3 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig831.4.3 vs. uniprot
Match: D7G0N6_ECTSI (Ubiquitin-like protein ATG12 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0N6_ECTSI) HSP 1 Score: 102 bits (253), Expect = 5.360e-24 Identity = 49/74 (66.22%), Postives = 58/74 (78.38%), Query Frame = 0 Query: 2 DLTIHPGKIHLVHEILYGGVTGSVRVFGSLKRYDAATDEAFIEYKGETLTVGTSLIPGFQFRQNSLFEFIGEIE 75 DLTI PGKIHLV EIL GVTGSVRV GSLK YDAA D A ++YKG+ LT+ L+ FQFR +SL+EFIGE++ Sbjct: 5 DLTIQPGKIHLVREILRDGVTGSVRVLGSLKSYDAAADVAVVDYKGDQLTIDACLLTDFQFRIDSLYEFIGEVQ 78
BLAST of mRNA_C-tenellus_contig831.4.3 vs. uniprot
Match: A0A1S8W7W3_9FUNG (Uncharacterized protein n=1 Tax=Batrachochytrium salamandrivorans TaxID=1357716 RepID=A0A1S8W7W3_9FUNG) HSP 1 Score: 49.3 bits (116), Expect = 5.460e-5 Identity = 22/52 (42.31%), Postives = 37/52 (71.15%), Query Frame = 0 Query: 25 VRVFGSLKRYDAATDEAFIEYKGETLTVGTSLIPGFQFRQNSLFEFIGEIEV 76 VR+ G L+ Y+ T+ A +EY+G+ L V T+L+ F ++ NSL+++IGE+ V Sbjct: 6 VRILGRLRSYNVHTNMAQVEYRGQQLLVDTALLGIFDYKINSLYQWIGELVV 57 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig831.4.3 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig831.4.3 ID=prot_C-tenellus_contig831.4.3|Name=mRNA_C-tenellus_contig831.4.3|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=145bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|