prot_C-tenellus_contig8233.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig8233.1.1 vs. uniprot
Match: A0A6H5L780_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L780_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 2.750e-8 Identity = 23/54 (42.59%), Postives = 38/54 (70.37%), Query Frame = 0 Query: 5 LHIWSDGCGSQFKNRRQMWWVSQSLARTGISVVNNFFASCHGKSLSDGVGAVVK 58 +H+++DGCG Q+K +R V+QSL R G+ +++NF + H K DG+GA++K Sbjct: 295 VHMFTDGCGKQYKGKRNFRAVAQSLRRLGVRILHNFAVTSHFKGTHDGIGALMK 348
BLAST of mRNA_C-tenellus_contig8233.1.1 vs. uniprot
Match: A0A6H5K7E6_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K7E6_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 2.770e-8 Identity = 23/54 (42.59%), Postives = 38/54 (70.37%), Query Frame = 0 Query: 5 LHIWSDGCGSQFKNRRQMWWVSQSLARTGISVVNNFFASCHGKSLSDGVGAVVK 58 +H+++DGCG Q+K +R V+QSL R G+ +++NF + H K DG+GA++K Sbjct: 651 VHMFTDGCGKQYKGKRNFRAVAQSLRRLGVRILHNFAVTSHFKGTHDGIGALMK 704
BLAST of mRNA_C-tenellus_contig8233.1.1 vs. uniprot
Match: A0A6H5KHC6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KHC6_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 3.350e-7 Identity = 23/54 (42.59%), Postives = 36/54 (66.67%), Query Frame = 0 Query: 5 LHIWSDGCGSQFKNRRQMWWVSQSLARTGISVVNNFFASCHGKSLSDGVGAVVK 58 +H+++DGCG Q+K +R V+QSL R G+ + +NF + H K DG+GA +K Sbjct: 151 VHMFTDGCGKQYKGKRNFRAVAQSLNRLGVRISHNFAVTSHFKGTHDGIGAHMK 204
BLAST of mRNA_C-tenellus_contig8233.1.1 vs. uniprot
Match: A0A6H5JQK2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQK2_9PHAE) HSP 1 Score: 53.1 bits (126), Expect = 1.180e-6 Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = 0 Query: 5 LHIWSDGCGSQFKNRRQMWWVSQSLARTGISVVNNFFASCHGKSLSDGVGAVVK 58 +HI+SDGCG Q+K RR +++ S+ + G + ++F A+ H K DG+G V K Sbjct: 428 IHIFSDGCGKQYKGRRNFRFLADSVRQLGFFIDHHFAATSHFKGCHDGIGGVAK 481
BLAST of mRNA_C-tenellus_contig8233.1.1 vs. uniprot
Match: A0A6H5KFH7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFH7_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 2.670e-6 Identity = 20/54 (37.04%), Postives = 35/54 (64.81%), Query Frame = 0 Query: 5 LHIWSDGCGSQFKNRRQMWWVSQSLARTGISVVNNFFASCHGKSLSDGVGAVVK 58 +H+++DGCG Q+K RR +++ S+ + G + ++F A+ H K DG+G V K Sbjct: 26 IHMFTDGCGKQYKGRRNFRFLADSVRQIGFFIDHHFAATSHFKGCHDGIGGVAK 79
BLAST of mRNA_C-tenellus_contig8233.1.1 vs. uniprot
Match: A0A6H5KI10_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KI10_9PHAE) HSP 1 Score: 51.6 bits (122), Expect = 4.150e-6 Identity = 21/54 (38.89%), Postives = 35/54 (64.81%), Query Frame = 0 Query: 5 LHIWSDGCGSQFKNRRQMWWVSQSLARTGISVVNNFFASCHGKSLSDGVGAVVK 58 LH+++DGCG Q+K RR +++ S+ + G + ++F A+ H K DG+G V K Sbjct: 620 LHMFTDGCGKQYKGRRNFRFLADSVRQIGFFIDHHFAATSHFKGCHDGIGGVAK 673
BLAST of mRNA_C-tenellus_contig8233.1.1 vs. uniprot
Match: A0A6H5JQG9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JQG9_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 5.480e-6 Identity = 21/54 (38.89%), Postives = 35/54 (64.81%), Query Frame = 0 Query: 5 LHIWSDGCGSQFKNRRQMWWVSQSLARTGISVVNNFFASCHGKSLSDGVGAVVK 58 +HI++DGCG Q+K RR +++ S+ + G + ++F A+ H K DG+G V K Sbjct: 142 IHIFTDGCGKQYKGRRSFRFLADSVRQIGSFIDHHFAATSHFKGCHDGIGGVAK 195
BLAST of mRNA_C-tenellus_contig8233.1.1 vs. uniprot
Match: A7RSN4_NEMVE (Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7RSN4_NEMVE) HSP 1 Score: 51.2 bits (121), Expect = 5.600e-6 Identity = 25/56 (44.64%), Postives = 31/56 (55.36%), Query Frame = 0 Query: 3 EILHIWSDGCGSQFKNRRQMWWVSQSLARTGISVVNNFFASCHGKSLSDGVGAVVK 58 E +H WSDG GSQFKNR + + G +FF + HGK DG+GA VK Sbjct: 63 EKVHYWSDGAGSQFKNRYNLSCLLYHQRDFGSEATWSFFETAHGKGPCDGIGAKVK 118
BLAST of mRNA_C-tenellus_contig8233.1.1 vs. uniprot
Match: A0A6H5L293_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L293_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 5.670e-6 Identity = 21/54 (38.89%), Postives = 35/54 (64.81%), Query Frame = 0 Query: 5 LHIWSDGCGSQFKNRRQMWWVSQSLARTGISVVNNFFASCHGKSLSDGVGAVVK 58 +HI++DGCG Q+K RR +++ S+ + G + ++F A+ H K DG+G V K Sbjct: 448 IHIFTDGCGKQYKGRRSFRFLADSVRQIGSFIDHHFAATSHFKGCHDGIGGVAK 501
BLAST of mRNA_C-tenellus_contig8233.1.1 vs. uniprot
Match: A0A6H5JYM9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYM9_9PHAE) HSP 1 Score: 50.8 bits (120), Expect = 7.060e-6 Identity = 20/54 (37.04%), Postives = 35/54 (64.81%), Query Frame = 0 Query: 5 LHIWSDGCGSQFKNRRQMWWVSQSLARTGISVVNNFFASCHGKSLSDGVGAVVK 58 +H+++DGCG Q+K RR +++ S+ + G + ++F A+ H K DG+G V K Sbjct: 70 IHMFTDGCGKQYKGRRNFRFLTDSVRQIGFFIDHHFAATSHFKDCHDGIGGVAK 123 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig8233.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 17
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig8233.1.1 ID=prot_C-tenellus_contig8233.1.1|Name=mRNA_C-tenellus_contig8233.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=58bpback to top |