prot_C-tenellus_contig8211.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig8211.2.1 vs. uniprot
Match: A0A6H5KMD5_9PHAE (Aldo_ket_red domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KMD5_9PHAE) HSP 1 Score: 78.2 bits (191), Expect = 2.180e-14 Identity = 34/43 (79.07%), Postives = 39/43 (90.70%), Query Frame = 0 Query: 59 AEDRVDLGGLKVSPLGIGAWAWGDTAFWGYSEAMDLELQEVGG 101 A+DRV LGG++VSPLG+GAW+WGDT FWGYSEAMD ELQEV G Sbjct: 93 AKDRVSLGGVEVSPLGVGAWSWGDTVFWGYSEAMDKELQEVFG 135
BLAST of mRNA_C-tenellus_contig8211.2.1 vs. uniprot
Match: A0A7S0Z2L4_9CRYP (Hypothetical protein (Fragment) n=1 Tax=Hemiselmis tepida TaxID=464990 RepID=A0A7S0Z2L4_9CRYP) HSP 1 Score: 60.5 bits (145), Expect = 3.070e-8 Identity = 35/80 (43.75%), Postives = 44/80 (55.00%), Query Frame = 0 Query: 20 FVLPSSTLSPALQARSKWRCRGSLNSMAGVQSEATIDSVAEDRVDLGGLKVSPLGIGAWAWGDTAFWGYSEAMDLELQEV 99 F PS SPA AR G + + G A+ + +V GGL+VS +GIG WAWG+ WGY E+MD ELQEV Sbjct: 31 FSRPSLCRSPASVARVSM---GIFDGIFGGGQGASSATPPGRKVPFGGLEVSEMGIGTWAWGNKLLWGYDESMDAELQEV 107
BLAST of mRNA_C-tenellus_contig8211.2.1 vs. uniprot
Match: D8S5Z4_SELML (Aldo_ket_red domain-containing protein n=4 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8S5Z4_SELML) HSP 1 Score: 58.5 bits (140), Expect = 1.710e-7 Identity = 23/39 (58.97%), Postives = 32/39 (82.05%), Query Frame = 0 Query: 61 DRVDLGGLKVSPLGIGAWAWGDTAFWGYSEAMDLELQEV 99 D+V LG +KVSP+G+G WAWG+T WGY+ +MD ELQ++ Sbjct: 8 DKVKLGPVKVSPMGLGTWAWGNTLLWGYNPSMDNELQQL 46
BLAST of mRNA_C-tenellus_contig8211.2.1 vs. uniprot
Match: A0A4P1RDA5_LUPAN (Aldo_ket_red domain-containing protein n=2 Tax=Magnoliopsida TaxID=3398 RepID=A0A4P1RDA5_LUPAN) HSP 1 Score: 58.2 bits (139), Expect = 2.820e-7 Identity = 30/51 (58.82%), Postives = 36/51 (70.59%), Query Frame = 0 Query: 38 RCRGSLNSMAGVQSEATIDSVAEDRVDLGG--LKVSPLGIGAWAWGDTAFW 86 R GS +S S AT+ +V ED+V LGG LKVSPLGIGAW+WGDT +W Sbjct: 23 RAEGSSSS----SSSATLKTVVEDKVKLGGSDLKVSPLGIGAWSWGDTTYW 69
BLAST of mRNA_C-tenellus_contig8211.2.1 vs. uniprot
Match: A0A1Y1HH25_KLENI (NAD(P)-linked oxidoreductase superfamily protein n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1HH25_KLENI) HSP 1 Score: 57.4 bits (137), Expect = 4.830e-7 Identity = 26/39 (66.67%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 61 DRVDLGGLKVSPLGIGAWAWGDTAFWGYSEAMDLELQEV 99 DRV LG LKVSP+GIG WA+G+ WGY E MD ELQ+V Sbjct: 112 DRVTLGPLKVSPMGIGTWAFGNRLLWGYEEEMDGELQDV 150
BLAST of mRNA_C-tenellus_contig8211.2.1 vs. uniprot
Match: A0A150FZK5_GONPE (Aldo_ket_red domain-containing protein n=1 Tax=Gonium pectorale TaxID=33097 RepID=A0A150FZK5_GONPE) HSP 1 Score: 53.5 bits (127), Expect = 1.930e-6 Identity = 21/39 (53.85%), Postives = 29/39 (74.36%), Query Frame = 0 Query: 61 DRVDLGGLKVSPLGIGAWAWGDTAFWGYSEAMDLELQEV 99 + V LG LKVSP+G+G W+WG+ WGY E+ D ELQ++ Sbjct: 66 EMVPLGDLKVSPMGLGTWSWGNRFLWGYDESQDPELQQL 104
BLAST of mRNA_C-tenellus_contig8211.2.1 vs. uniprot
Match: A0A7S0YXB6_9CRYP (Hypothetical protein (Fragment) n=1 Tax=Hemiselmis tepida TaxID=464990 RepID=A0A7S0YXB6_9CRYP) HSP 1 Score: 54.7 bits (130), Expect = 2.090e-6 Identity = 24/36 (66.67%), Postives = 30/36 (83.33%), Query Frame = 0 Query: 59 AEDRVDL-GGLKVSPLGIGAWAWGDTAFWGYSEAMD 93 AEDR+ L GGL+VS LGIGAW+WGD+ FWGY + M+ Sbjct: 46 AEDRITLAGGLEVSKLGIGAWSWGDSLFWGYDKDME 81
BLAST of mRNA_C-tenellus_contig8211.2.1 vs. uniprot
Match: A0A5J4XIA4_9CHLO (Aldo-keto reductase oxidoreductase n=1 Tax=Trebouxia sp. A1-2 TaxID=2608996 RepID=A0A5J4XIA4_9CHLO) HSP 1 Score: 55.1 bits (131), Expect = 3.000e-6 Identity = 21/39 (53.85%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 61 DRVDLGGLKVSPLGIGAWAWGDTAFWGYSEAMDLELQEV 99 D+ +G LKVSP+G+G WAWG+ WGY ++MD ELQ++ Sbjct: 58 DQKQIGPLKVSPMGLGTWAWGNQLLWGYDKSMDQELQQL 96
BLAST of mRNA_C-tenellus_contig8211.2.1 vs. uniprot
Match: A0A8J4CBP1_9CHLO (Aldo_ket_red domain-containing protein n=2 Tax=Volvox TaxID=3066 RepID=A0A8J4CBP1_9CHLO) HSP 1 Score: 54.3 bits (129), Expect = 5.620e-6 Identity = 21/39 (53.85%), Postives = 29/39 (74.36%), Query Frame = 0 Query: 61 DRVDLGGLKVSPLGIGAWAWGDTAFWGYSEAMDLELQEV 99 + V LG LKVSP+G+G W+WG+ WGY E+ D ELQ++ Sbjct: 67 ELVPLGSLKVSPMGLGTWSWGNRFLWGYDESQDPELQQI 105
BLAST of mRNA_C-tenellus_contig8211.2.1 vs. uniprot
Match: A0A1Z5KI42_FISSO (Aldo_ket_red domain-containing protein n=2 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5KI42_FISSO) HSP 1 Score: 54.3 bits (129), Expect = 5.620e-6 Identity = 22/52 (42.31%), Postives = 32/52 (61.54%), Query Frame = 0 Query: 48 GVQSEATIDSVAEDRVDLGGLKVSPLGIGAWAWGDTAFWGYSEAMDLELQEV 99 G+ +A + + L + + PLG+GAWAWGD+ FWGY+ D ELQ+V Sbjct: 48 GLPQQAAVAQSTTNTAPLTSISLPPLGLGAWAWGDSLFWGYNPKNDAELQQV 99 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig8211.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 23
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig8211.2.1 ID=prot_C-tenellus_contig8211.2.1|Name=mRNA_C-tenellus_contig8211.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=129bpback to top |