prot_C-tenellus_contig8208.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig8208.1.1 vs. uniprot
Match: D0MUD0_PHYIT (Uncharacterized protein n=11 Tax=Phytophthora TaxID=4783 RepID=D0MUD0_PHYIT) HSP 1 Score: 64.3 bits (155), Expect = 1.080e-11 Identity = 28/48 (58.33%), Postives = 36/48 (75.00%), Query Frame = 0 Query: 2 AVPVCNSLTFFFTAVTAWAMGESFQRPARTLAGMGLVLVGIGVCILSK 49 AVP+CNSLTF FTA+T+ +GE QRPA T GM L+L+G+ +C SK Sbjct: 84 AVPICNSLTFVFTAITSRLLGEKPQRPASTYTGMVLILLGVAICFNSK 131
BLAST of mRNA_C-tenellus_contig8208.1.1 vs. uniprot
Match: D7G2X6_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G2X6_ECTSI) HSP 1 Score: 64.3 bits (155), Expect = 1.310e-11 Identity = 31/56 (55.36%), Postives = 40/56 (71.43%), Query Frame = 0 Query: 2 AVPVCNSLTFFFTAVTAWAMGESFQRPARTLAGMGLVLVGIGVCILSKAS--TTVP 55 AVPVCN+L+ FTA TA A+GE RP RT++G+ L L+G+ VC+ SKA T VP Sbjct: 88 AVPVCNALSLVFTAATAMALGEKVDRPLRTVSGIVLALMGLAVCVASKAQLLTLVP 143
BLAST of mRNA_C-tenellus_contig8208.1.1 vs. uniprot
Match: A0A225WLS3_9STRA (Putative membrane protein n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225WLS3_9STRA) HSP 1 Score: 63.5 bits (153), Expect = 2.250e-11 Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 0 Query: 2 AVPVCNSLTFFFTAVTAWAMGESFQRPARTLAGMGLVLVGIGVCILSKASTTV 54 AVP+CNSLTF FTA+T+ +GE QRP T GM L+L+G+ +C SK +V Sbjct: 84 AVPICNSLTFVFTAITSRLLGEKPQRPVSTYTGMFLILLGVAICFDSKQQVSV 136
BLAST of mRNA_C-tenellus_contig8208.1.1 vs. uniprot
Match: H3HB45_PHYRM (Uncharacterized protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3HB45_PHYRM) HSP 1 Score: 64.3 bits (155), Expect = 5.920e-11 Identity = 28/48 (58.33%), Postives = 36/48 (75.00%), Query Frame = 0 Query: 2 AVPVCNSLTFFFTAVTAWAMGESFQRPARTLAGMGLVLVGIGVCILSK 49 AVP+CNSLTF FTA+T+ +GE QRPA T GM L+L+G+ +C SK Sbjct: 31 AVPICNSLTFVFTAITSRLLGEKPQRPASTYTGMVLILLGVAICFNSK 78
BLAST of mRNA_C-tenellus_contig8208.1.1 vs. uniprot
Match: A0A3R7KFJ3_9STRA (Uncharacterized protein n=3 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3R7KFJ3_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 6.640e-11 Identity = 27/48 (56.25%), Postives = 35/48 (72.92%), Query Frame = 0 Query: 2 AVPVCNSLTFFFTAVTAWAMGESFQRPARTLAGMGLVLVGIGVCILSK 49 AVP+CNSLTF FTA+T+ +GE QRP T GM L+L+G+ +C SK Sbjct: 86 AVPICNSLTFVFTAITSRLLGEKPQRPISTYTGMVLILLGVAICFNSK 133
BLAST of mRNA_C-tenellus_contig8208.1.1 vs. uniprot
Match: W7TFX4_9STRA (Proteasome subunit alpha n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TFX4_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 8.720e-11 Identity = 27/49 (55.10%), Postives = 38/49 (77.55%), Query Frame = 0 Query: 1 MAVPVCNSLTFFFTAVTAWAMGESFQRPARTLAGMGLVLVGIGVCILSK 49 +AVP+CNSLTF FTA+T++ +GE RPAR G+ VLVG+ +C++SK Sbjct: 314 LAVPLCNSLTFVFTAITSYLLGERLDRPARASLGVFFVLVGVTLCVVSK 362
BLAST of mRNA_C-tenellus_contig8208.1.1 vs. uniprot
Match: W2P4A6_PHYPR (BCNT-C domain-containing protein n=1 Tax=Phytophthora parasitica TaxID=4792 RepID=W2P4A6_PHYPR) HSP 1 Score: 64.3 bits (155), Expect = 1.180e-10 Identity = 28/48 (58.33%), Postives = 36/48 (75.00%), Query Frame = 0 Query: 2 AVPVCNSLTFFFTAVTAWAMGESFQRPARTLAGMGLVLVGIGVCILSK 49 AVP+CNSLTF FTA+T+ +GE QRPA T GM L+L+G+ +C SK Sbjct: 84 AVPICNSLTFVFTAITSRLLGEKPQRPASTYTGMVLILLGVAICFNSK 131
BLAST of mRNA_C-tenellus_contig8208.1.1 vs. uniprot
Match: A0A2P4WX60_9STRA (BCNT-C domain-containing protein n=1 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4WX60_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 1.180e-10 Identity = 28/52 (53.85%), Postives = 38/52 (73.08%), Query Frame = 0 Query: 2 AVPVCNSLTFFFTAVTAWAMGESFQRPARTLAGMGLVLVGIGVCILSKASTT 53 AVP+CNSLTF FTA+T+ +GE QRPA T GM L+L+G+ +C SK ++ Sbjct: 91 AVPICNSLTFVFTAITSRLLGEKPQRPASTYTGMILILLGVAICFNSKQDSS 142
BLAST of mRNA_C-tenellus_contig8208.1.1 vs. uniprot
Match: M4C2Y1_HYAAE (Uncharacterized protein n=1 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4C2Y1_HYAAE) HSP 1 Score: 60.8 bits (146), Expect = 2.540e-10 Identity = 27/48 (56.25%), Postives = 35/48 (72.92%), Query Frame = 0 Query: 2 AVPVCNSLTFFFTAVTAWAMGESFQRPARTLAGMGLVLVGIGVCILSK 49 AVP+CNSLTF FTA+T+ +GE QRP T GM LVL+G+ +C S+ Sbjct: 84 AVPICNSLTFVFTAITSRLLGEKPQRPICTYMGMALVLLGVAICFDSQ 131
BLAST of mRNA_C-tenellus_contig8208.1.1 vs. uniprot
Match: A0A7S2CTM5_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2CTM5_9STRA) HSP 1 Score: 60.8 bits (146), Expect = 2.870e-10 Identity = 25/49 (51.02%), Postives = 33/49 (67.35%), Query Frame = 0 Query: 1 MAVPVCNSLTFFFTAVTAWAMGESFQRPARTLAGMGLVLVGIGVCILSK 49 MAVP+CNSLTF FTA+T W +GE P + G+ VLVG+ +C+L Sbjct: 94 MAVPICNSLTFVFTAITGWLLGERLGSPMCAVFGITCVLVGVTICVLDS 142 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig8208.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig8208.1.1 ID=prot_C-tenellus_contig8208.1.1|Name=mRNA_C-tenellus_contig8208.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=57bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|