prot_C-tenellus_contig8201.5.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig8201.5.1 vs. uniprot
Match: D8LDB0_ECTSI (C2H2 zinc finger protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDB0_ECTSI) HSP 1 Score: 82.4 bits (202), Expect = 3.480e-17 Identity = 36/50 (72.00%), Postives = 44/50 (88.00%), Query Frame = 0 Query: 1 ISLGTAAFYFRQRHGRLDWNKLARVNVDEVIREVDLPVLQNLLDEVRGCK 50 +SLG AFYFRQRHG+LDW KLAR++VDEV+REVD+ VLQ+LLDEV C+ Sbjct: 10 VSLGPVAFYFRQRHGKLDWKKLARIDVDEVVREVDIAVLQDLLDEVAFCE 59
BLAST of mRNA_C-tenellus_contig8201.5.1 vs. uniprot
Match: A0A836CKW3_9STRA (C2H2 zinc finger protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CKW3_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 1.510e-8 Identity = 25/44 (56.82%), Postives = 36/44 (81.82%), Query Frame = 0 Query: 7 AFYFRQRHGRLDWNKLARVNVDEVIREVDLPVLQNLLDEVRGCK 50 AF+FRQR G ++W+KLA+V+VDEV++EVDL LQ++LD+ K Sbjct: 3 AFHFRQRSGAMNWSKLAKVDVDEVVQEVDLAALQSILDDCTFSK 46
BLAST of mRNA_C-tenellus_contig8201.5.1 vs. uniprot
Match: UPI0014558B42 (zinc finger protein DZIP1L-like isoform X1 n=4 Tax=Asterias rubens TaxID=7604 RepID=UPI0014558B42) HSP 1 Score: 50.1 bits (118), Expect = 1.070e-5 Identity = 21/46 (45.65%), Postives = 30/46 (65.22%), Query Frame = 0 Query: 4 GTAAFYFRQRHGRLDWNKLARVNVDEVIREVDLPVLQNLLDEVRGC 49 G F F+ RH R+DW K+A V+VD V+RE+D LQ+++ V C Sbjct: 39 GVPGFTFQTRHDRIDWRKMASVDVDRVMRELDFATLQDVIMNVTFC 84
BLAST of mRNA_C-tenellus_contig8201.5.1 vs. uniprot
Match: A0A7S2VWI1_9STRA (Hypothetical protein (Fragment) n=1 Tax=Triparma pacifica TaxID=91992 RepID=A0A7S2VWI1_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 1.920e-5 Identity = 20/37 (54.05%), Postives = 29/37 (78.38%), Query Frame = 0 Query: 8 FYFRQRHGRLDWNKLARVNVDEVIREVDLPVLQNLLD 44 F+FRQR G + WNKL ++V+ ++R+VDL LQ+LLD Sbjct: 41 FFFRQRAGSMPWNKLETLDVERIVRDVDLDALQSLLD 77
BLAST of mRNA_C-tenellus_contig8201.5.1 vs. uniprot
Match: A0A4P9WGZ3_9FUNG (Iguana/Dzip1-like DAZ-interacting protein N-terminal-domain-containing protein (Fragment) n=1 Tax=Blyttiomyces helicus TaxID=388810 RepID=A0A4P9WGZ3_9FUNG) HSP 1 Score: 48.5 bits (114), Expect = 3.750e-5 Identity = 19/42 (45.24%), Postives = 29/42 (69.05%), Query Frame = 0 Query: 8 FYFRQRHGRLDWNKLARVNVDEVIREVDLPVLQNLLDEVRGC 49 FYFR+R RL+W LA V VD +++EVD+ LQ +++ + C Sbjct: 62 FYFRKRRDRLNWRLLASVQVDRIMKEVDIGCLQEIMENITYC 103
BLAST of mRNA_C-tenellus_contig8201.5.1 vs. uniprot
Match: A0A507C479_9FUNG (C2H2-type domain-containing protein n=1 Tax=Synchytrium microbalum TaxID=1806994 RepID=A0A507C479_9FUNG) HSP 1 Score: 48.5 bits (114), Expect = 3.770e-5 Identity = 21/42 (50.00%), Postives = 28/42 (66.67%), Query Frame = 0 Query: 8 FYFRQRHGRLDWNKLARVNVDEVIREVDLPVLQNLLDEVRGC 49 FYFR+R RL+W LA V +D +IREVDL LQ + + + C Sbjct: 51 FYFRRRRERLNWRALAGVQLDNIIREVDLDSLQEVTENIAFC 92 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig8201.5.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 6
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig8201.5.1 ID=prot_C-tenellus_contig8201.5.1|Name=mRNA_C-tenellus_contig8201.5.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=51bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|