prot_C-tenellus_contig7257.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7257.1.1 vs. uniprot
Match: D7FUI1_ECTSI (Ankyrin repeat protein E2_17 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FUI1_ECTSI) HSP 1 Score: 94.4 bits (233), Expect = 5.520e-23 Identity = 43/63 (68.25%), Postives = 50/63 (79.37%), Query Frame = 0 Query: 31 VDGFGLCALHYAVWNGQERCVEILCANDIGRDRNGLQRSCVNLQSSKGYTALHLAASDGAQGI 93 +D FGL ALHYA WNG RCVEILC ND+G D GLQRSC++L+S KG+T LHLAASDG G+ Sbjct: 1 MDDFGLSALHYASWNGHVRCVEILCINDLGHDGAGLQRSCIDLRSIKGWTPLHLAASDGVNGM 63
BLAST of mRNA_C-tenellus_contig7257.1.1 vs. uniprot
Match: A0A482S1M6_9ARCH (Ankyrin repeat protein n=1 Tax=archaeon TaxID=1906665 RepID=A0A482S1M6_9ARCH) HSP 1 Score: 71.2 bits (173), Expect = 3.180e-14 Identity = 35/83 (42.17%), Postives = 50/83 (60.24%), Query Frame = 0 Query: 1 MSGDLLRRKAIFGDGEGIKALLEQGANPCSVDGFGLCALHYAVWNGQERCVEILCANDIGRDRNGLQRSCVNLQSSKGYTALH 83 MS +R+ I E ++ L++ AN CS+D +GL ALHYAVWNG CV++L N G D G + +C+N++S G T H Sbjct: 1 MSEAKVRQACIHNRIEELEVLVKARANVCSIDEWGLTALHYAVWNGHVECVKLLVFNSHGVDSKGQKTTCLNMKSCIGLTGTH 83
BLAST of mRNA_C-tenellus_contig7257.1.1 vs. uniprot
Match: A0A835Z6I7_9STRA (Ankyrin repeat protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z6I7_9STRA) HSP 1 Score: 69.3 bits (168), Expect = 2.290e-13 Identity = 32/54 (59.26%), Postives = 40/54 (74.07%), Query Frame = 0 Query: 35 GLCALHYAVWNGQERCVEILCANDIGRDRNGLQRSCVNLQSSKGYTALHLAASD 88 GL ALHYAV+NG CVE+LCAN G D NG SC+++ S+ G TALHLAA++ Sbjct: 5 GLTALHYAVFNGNTLCVEVLCANASGHDANGHHCSCIDMVSTMGCTALHLAAAE 58 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7257.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig7257.1.1 ID=prot_C-tenellus_contig7257.1.1|Name=mRNA_C-tenellus_contig7257.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=93bpback to top |