prot_C-tenellus_contig6842.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig6842.1.1 vs. uniprot
Match: A0A3B9F8T1_9NOST (Conjugal transfer protein n=1 Tax=Richelia sp. TaxID=2053605 RepID=A0A3B9F8T1_9NOST) HSP 1 Score: 79.7 bits (195), Expect = 2.520e-17 Identity = 38/66 (57.58%), Postives = 48/66 (72.73%), Query Frame = 0 Query: 1 LRTKAGLDYLPTNALYGALLSIKKDLDANENLVSGWIVKGNAAFNKEKQEATPVILKFGDEPNKNI 66 L KA LDYLP+NALYG LL +K ++ +EN++ WIV+GN NKEK+ AT VILKF +EP K I Sbjct: 43 LIAKADLDYLPSNALYGGLLFLKTQIEDDENIIGRWIVEGNKQLNKEKKNATAVILKFPEEPAKTI 108
BLAST of mRNA_C-tenellus_contig6842.1.1 vs. uniprot
Match: A0A8K1IY95_9RICK (Conjugal transfer protein TraD n=1 Tax=Rickettsia endosymbiont of Culicoides impunctatus TaxID=2867440 RepID=A0A8K1IY95_9RICK) HSP 1 Score: 65.5 bits (158), Expect = 9.470e-12 Identity = 31/66 (46.97%), Postives = 44/66 (66.67%), Query Frame = 0 Query: 1 LRTKAGLDYLPTNALYGALLSIKKDLDANENLVSGWIVKGNAAFNKEKQEATPVILKFGDEPNKNI 66 L KA LD+LPTN LYG+LLS+K+ L+ ++ W G A FN+E+Q+ T VILK ++P+ I Sbjct: 43 LIVKAELDHLPTNTLYGSLLSLKESLEKQSDIQDQWTKTGKATFNQEQQQKTAVILKLDEKPSLEI 108
BLAST of mRNA_C-tenellus_contig6842.1.1 vs. uniprot
Match: A0A2U3R077_ORITS (Conjugative transfer protein n=1 Tax=Orientia tsutsugamushi TaxID=784 RepID=A0A2U3R077_ORITS) HSP 1 Score: 63.2 bits (152), Expect = 3.390e-11 Identity = 30/65 (46.15%), Postives = 42/65 (64.62%), Query Frame = 0 Query: 1 LRTKAGLDYLPTNALYGALLSIKKDLDANENLVSGWIVKGNAAFNKEKQEATPVILKFGDEPNKN 65 L KA LD+LPTN L+GA++S+K+ L + N+ W G F+KE+Q VILKF EP++N Sbjct: 43 LLAKAELDHLPTNTLFGAIVSLKETLTQHPNVQDHWTTIGKDIFDKEQQNKAAVILKFASEPDEN 107
BLAST of mRNA_C-tenellus_contig6842.1.1 vs. uniprot
Match: A0A2U3RTN4_ORITS (Conjugative transfer protein n=1 Tax=Orientia tsutsugamushi TaxID=784 RepID=A0A2U3RTN4_ORITS) HSP 1 Score: 62.8 bits (151), Expect = 4.910e-11 Identity = 30/65 (46.15%), Postives = 42/65 (64.62%), Query Frame = 0 Query: 1 LRTKAGLDYLPTNALYGALLSIKKDLDANENLVSGWIVKGNAAFNKEKQEATPVILKFGDEPNKN 65 L KA LD+LPTN L+GA++S+K+ L + N+ W G F+KE+Q VILKF EP++N Sbjct: 43 LVAKAKLDHLPTNTLFGAIVSLKETLTQHPNVQDHWTTIGKDIFDKEQQNKAAVILKFASEPDEN 107
BLAST of mRNA_C-tenellus_contig6842.1.1 vs. uniprot
Match: A0A8K1MRR6_9RICK (Conjugal transfer protein TraD n=1 Tax=Rickettsia endosymbiont of Culicoides impunctatus TaxID=2867440 RepID=A0A8K1MRR6_9RICK) HSP 1 Score: 63.5 bits (153), Expect = 5.090e-11 Identity = 31/66 (46.97%), Postives = 43/66 (65.15%), Query Frame = 0 Query: 1 LRTKAGLDYLPTNALYGALLSIKKDLDANENLVSGWIVKGNAAFNKEKQEATPVILKFGDEPNKNI 66 L KA LD+LPTN LYG+LLS+K L + N+ W G AF++E+Q+ T VILK ++P+ I Sbjct: 43 LIVKAELDHLPTNTLYGSLLSLKDSLTSQSNIKDQWTKTGKYAFDQEQQQKTAVILKLDEKPSLEI 108
BLAST of mRNA_C-tenellus_contig6842.1.1 vs. uniprot
Match: A0A0F3NUV2_ORITS (Conjugal transfer TraD family protein n=7 Tax=Orientia tsutsugamushi TaxID=784 RepID=A0A0F3NUV2_ORITS) HSP 1 Score: 62.8 bits (151), Expect = 7.150e-11 Identity = 30/65 (46.15%), Postives = 42/65 (64.62%), Query Frame = 0 Query: 1 LRTKAGLDYLPTNALYGALLSIKKDLDANENLVSGWIVKGNAAFNKEKQEATPVILKFGDEPNKN 65 L KA LD+LPTN L+GA++S+K+ L + N+ W G F+KE+Q VILKF EP++N Sbjct: 43 LVAKAKLDHLPTNTLFGAIVSLKETLTQHPNVQDHWTTIGKDIFDKEQQNKAAVILKFASEPDEN 107
BLAST of mRNA_C-tenellus_contig6842.1.1 vs. uniprot
Match: A5CE86_ORITB (Conjugative transfer protein n=19 Tax=Orientia tsutsugamushi TaxID=784 RepID=A5CE86_ORITB) HSP 1 Score: 60.5 bits (145), Expect = 7.790e-10 Identity = 29/65 (44.62%), Postives = 43/65 (66.15%), Query Frame = 0 Query: 1 LRTKAGLDYLPTNALYGALLSIKKDLDANENLVSGWIVKGNAAFNKEKQEATPVILKFGDEPNKN 65 L KA LD+LPTN L+GA++S+K+ L + N+ + W G F+KE+Q VILKF EP+++ Sbjct: 43 LVAKAKLDHLPTNTLFGAIVSLKETLIQHPNVQNHWTTIGKDIFDKEQQNKAAVILKFSSEPDED 107
BLAST of mRNA_C-tenellus_contig6842.1.1 vs. uniprot
Match: A0A261DBX1_9RICK (Conjugative transfer protein n=2 Tax=unclassified Rickettsia TaxID=114295 RepID=A0A261DBX1_9RICK) HSP 1 Score: 59.3 bits (142), Expect = 2.390e-9 Identity = 29/66 (43.94%), Postives = 42/66 (63.64%), Query Frame = 0 Query: 1 LRTKAGLDYLPTNALYGALLSIKKDLDANENLVSGWIVKGNAAFNKEKQEATPVILKFGDEPNKNI 66 L KA LD+LPTN LYG+LLS+K L ++ W G A F++++Q+ T VILK ++P+ I Sbjct: 43 LIVKAELDHLPTNTLYGSLLSLKNSLTNQSDIQEQWTKTGKADFDQKQQQKTAVILKLDEKPSLEI 108
BLAST of mRNA_C-tenellus_contig6842.1.1 vs. uniprot
Match: A0A8E0WML3_9RICK (Conjugal transfer protein TraD n=2 Tax=spotted fever group TaxID=114277 RepID=A0A8E0WML3_9RICK) HSP 1 Score: 53.5 bits (127), Expect = 3.860e-7 Identity = 28/66 (42.42%), Postives = 42/66 (63.64%), Query Frame = 0 Query: 1 LRTKAGLDYLPTNALYGALLSIKKDLDANENLVSGWIVKGNAAFNKEKQEATPVILKFGDEPNKNI 66 L KA LD LPTN+L+GAL+S+K +L ++ W G F +E++ +T VILKF +P ++I Sbjct: 43 LVAKAELDNLPTNSLFGALVSLKNELTKYPDIQDHWRQIGRNIFEQEEKTSTAVILKFTSKPIESI 108 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig6842.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 9
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig6842.1.1 ID=prot_C-tenellus_contig6842.1.1|Name=mRNA_C-tenellus_contig6842.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=69bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|