prot_C-tenellus_contig6837.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig6837.1.1 vs. uniprot
Match: A0A835ZBW2_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZBW2_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 2.790e-8 Identity = 36/115 (31.30%), Postives = 62/115 (53.91%), Query Frame = 0 Query: 156 WTWGIGGFRIVK--SKQGRYADFQIVASYGGRLSWSVWKRFSDFSAFAGRIQSVGSRSGKTAASWGRVRRGQKIFRCLDPVYLKSKCILLEDFVRHALFETTDPSVLIAFVTQER 268 + W I RI+K S YA++ +V G + S W+R+SD +A + + + + +W V G++IFRC++P YL+ K LE F++ LFE + + L+ F +E+ Sbjct: 233 FAWAIPEIRILKGPSSSKEYAEYLVVGCLGDTILTS-WRRYSDLMEWAEDAKEL--KFARAVEAWEGVTGGKRIFRCVEPSYLRMKSYNLEHFLQQLLFEVSSYTELLQFFDKEK 344 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig6837.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig6837.1.1 ID=prot_C-tenellus_contig6837.1.1|Name=mRNA_C-tenellus_contig6837.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=271bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|