prot_C-tenellus_contig6800.3.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig6800.3.1 vs. uniprot
Match: A0A836CMD6_9STRA (DUF4110 domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CMD6_9STRA) HSP 1 Score: 87.4 bits (215), Expect = 7.080e-19 Identity = 35/47 (74.47%), Postives = 44/47 (93.62%), Query Frame = 0 Query: 3 VTVTSCESPPCPRANFTVTSLPSGDIMLFGGEYFDGQDTTCYNELYR 49 VTVT C++PP PRAN+++TSLPSGD+++FGGEYFDG+DT CYNELYR Sbjct: 47 VTVTPCDAPPSPRANYSMTSLPSGDMVMFGGEYFDGEDTMCYNELYR 93
BLAST of mRNA_C-tenellus_contig6800.3.1 vs. uniprot
Match: D8LC32_ECTSI (DUF4110 domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LC32_ECTSI) HSP 1 Score: 82.4 bits (202), Expect = 4.070e-17 Identity = 35/47 (74.47%), Postives = 41/47 (87.23%), Query Frame = 0 Query: 3 VTVTSCESPPCPRANFTVTSLPSGDIMLFGGEYFDGQDTTCYNELYR 49 VTVT C+ PP PRANFTVTSLPSGD++LFGGE FDGQDT C+ +L+R Sbjct: 42 VTVTVCDGPPSPRANFTVTSLPSGDMILFGGECFDGQDTKCFKDLFR 88
BLAST of mRNA_C-tenellus_contig6800.3.1 vs. uniprot
Match: A0A8K1CJ50_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1CJ50_PYTOL) HSP 1 Score: 70.1 bits (170), Expect = 8.820e-13 Identity = 28/48 (58.33%), Postives = 35/48 (72.92%), Query Frame = 0 Query: 2 KVTVTSCESPPCPRANFTVTSLPSGDIMLFGGEYFDGQDTTCYNELYR 49 K + + P PRANF++T LP+GD+M+FGGEYFDG CYNELYR Sbjct: 62 KEVIVEATTQPSPRANFSMTMLPTGDMMMFGGEYFDGDTNVCYNELYR 109
BLAST of mRNA_C-tenellus_contig6800.3.1 vs. uniprot
Match: W7TTW5_9STRA (Kelch-type beta propeller n=2 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TTW5_9STRA) HSP 1 Score: 67.8 bits (164), Expect = 5.740e-12 Identity = 29/49 (59.18%), Postives = 39/49 (79.59%), Query Frame = 0 Query: 2 KVTVTSCESP-PCPRANFTVTSLPSGDIMLFGGEYFDGQDTTCYNELYR 49 K VT E+P P PR NF++T+LPSG+++LFGGEY+DG+DT YN +YR Sbjct: 70 KTAVTISEAPQPSPRTNFSLTTLPSGELLLFGGEYYDGEDTIVYNGVYR 118
BLAST of mRNA_C-tenellus_contig6800.3.1 vs. uniprot
Match: F0WUK5_9STRA (Uncharacterized protein AlNc14C274G10016 n=4 Tax=Albugo laibachii Nc14 TaxID=890382 RepID=F0WUK5_9STRA) HSP 1 Score: 67.8 bits (164), Expect = 5.750e-12 Identity = 27/38 (71.05%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 12 PCPRANFTVTSLPSGDIMLFGGEYFDGQDTTCYNELYR 49 P PR NFT+T LP+G+IM+FGGEYFDG CYNELYR Sbjct: 71 PSPRGNFTMTMLPNGEIMVFGGEYFDGDVNVCYNELYR 108
BLAST of mRNA_C-tenellus_contig6800.3.1 vs. uniprot
Match: A0A4D9DFJ4_9STRA (Uncharacterized protein n=2 Tax=Monodopsidaceae TaxID=425072 RepID=A0A4D9DFJ4_9STRA) HSP 1 Score: 67.8 bits (164), Expect = 5.750e-12 Identity = 29/49 (59.18%), Postives = 39/49 (79.59%), Query Frame = 0 Query: 2 KVTVTSCESP-PCPRANFTVTSLPSGDIMLFGGEYFDGQDTTCYNELYR 49 K VT E+P P PR NF++T+LPSG+++LFGGEY+DG+DT YN +YR Sbjct: 705 KTAVTISEAPQPSPRTNFSLTTLPSGELLLFGGEYYDGEDTIVYNGVYR 753
BLAST of mRNA_C-tenellus_contig6800.3.1 vs. uniprot
Match: A0A397AIW7_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A397AIW7_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 1.280e-11 Identity = 24/38 (63.16%), Postives = 33/38 (86.84%), Query Frame = 0 Query: 12 PCPRANFTVTSLPSGDIMLFGGEYFDGQDTTCYNELYR 49 P PRANF+++S+ +GD+++FGGEYFDG+ CYNELYR Sbjct: 69 PSPRANFSLSSMVNGDLLMFGGEYFDGECNVCYNELYR 106
BLAST of mRNA_C-tenellus_contig6800.3.1 vs. uniprot
Match: A0A6G0WUG0_9STRA (DUF4110 domain-containing protein n=2 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0WUG0_9STRA) HSP 1 Score: 65.1 bits (157), Expect = 5.120e-11 Identity = 25/40 (62.50%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 10 SPPCPRANFTVTSLPSGDIMLFGGEYFDGQDTTCYNELYR 49 S P PRANF+++S+ +GD+++FGGEYFDG+ CYNELYR Sbjct: 67 SQPSPRANFSLSSMINGDLLMFGGEYFDGECNVCYNELYR 106
BLAST of mRNA_C-tenellus_contig6800.3.1 vs. uniprot
Match: A0A329SBG5_9STRA (DUF4110 domain-containing protein n=7 Tax=Phytophthora TaxID=4783 RepID=A0A329SBG5_9STRA) HSP 1 Score: 65.1 bits (157), Expect = 5.120e-11 Identity = 24/38 (63.16%), Postives = 33/38 (86.84%), Query Frame = 0 Query: 12 PCPRANFTVTSLPSGDIMLFGGEYFDGQDTTCYNELYR 49 P PRANFT+++LPSG+++LFGGEYFDG CYN++Y+ Sbjct: 72 PTPRANFTLSALPSGEMLLFGGEYFDGDVNVCYNDVYK 109
BLAST of mRNA_C-tenellus_contig6800.3.1 vs. uniprot
Match: A0A6A5A5E2_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=A0A6A5A5E2_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 6.800e-11 Identity = 24/38 (63.16%), Postives = 33/38 (86.84%), Query Frame = 0 Query: 12 PCPRANFTVTSLPSGDIMLFGGEYFDGQDTTCYNELYR 49 P PRANF+++S+ +GD+++FGGEYFDG+ CYNELYR Sbjct: 69 PSPRANFSLSSMVNGDLLMFGGEYFDGECNVCYNELYR 106 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig6800.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig6800.3.1 ID=prot_C-tenellus_contig6800.3.1|Name=mRNA_C-tenellus_contig6800.3.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=50bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|