prot_C-tenellus_contig6800.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig6800.1.1 vs. uniprot
Match: A0A6H5JRV5_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JRV5_9PHAE) HSP 1 Score: 55.8 bits (133), Expect = 4.350e-8 Identity = 24/31 (77.42%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 1 QGVHVEDIDCSLIVRPTRTALDLTFFDEGVY 31 +G+HVEDIDCSL+VRPTRTALDL FF E Y Sbjct: 10 KGLHVEDIDCSLVVRPTRTALDLRFFGEVSY 40
BLAST of mRNA_C-tenellus_contig6800.1.1 vs. uniprot
Match: D8LC33_ECTSI (RING-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LC33_ECTSI) HSP 1 Score: 55.8 bits (133), Expect = 3.390e-7 Identity = 24/31 (77.42%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 1 QGVHVEDIDCSLIVRPTRTALDLTFFDEGVY 31 +G+HVEDIDCSL+VRPTRTALDL FF E Y Sbjct: 10 KGLHVEDIDCSLVVRPTRTALDLRFFGEVSY 40 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig6800.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig6800.1.1 ID=prot_C-tenellus_contig6800.1.1|Name=mRNA_C-tenellus_contig6800.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=82bpback to top |