prot_C-tenellus_contig6759.4.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig6759.4.1 vs. uniprot
Match: A0A836CI77_9STRA (DENN domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CI77_9STRA) HSP 1 Score: 76.3 bits (186), Expect = 2.100e-14 Identity = 42/80 (52.50%), Postives = 52/80 (65.00%), Query Frame = 0 Query: 2 DPRQVYLVTPPFVVRPGNTSTEHDAVALVCS---SMPPEM--GTMVIRAEQMGKHDHWVRALAARLTPKEHQDRMVAIYG 76 +P V LVTPPF V G+ +TEHD VALV + + P E GT+VIRAE M H VRAL A+LTP+EH M ++YG Sbjct: 4048 EPASVSLVTPPFAVHSGHATTEHDCVALVWNQEAAAPGESVPGTLVIRAEDMTTHRMLVRALKAKLTPREHLTMMRSLYG 4127
BLAST of mRNA_C-tenellus_contig6759.4.1 vs. uniprot
Match: D7FYV2_ECTSI (PH domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FYV2_ECTSI) HSP 1 Score: 67.8 bits (164), Expect = 2.010e-11 Identity = 33/59 (55.93%), Postives = 39/59 (66.10%), Query Frame = 0 Query: 19 NTSTEHDAVALVCSSMPPEMGTMVIRAEQMGKHDHWVRALAARLTPKEHQDRMVAIYGG 77 + + E DAVALV P E GT+VIRAE + WVRALAARLT +EH RM +YGG Sbjct: 4787 DVTNERDAVALVVFRNPTETGTLVIRAESVEAQHVWVRALAARLTSREHHARMAELYGG 4845 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig6759.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig6759.4.1 ID=prot_C-tenellus_contig6759.4.1|Name=mRNA_C-tenellus_contig6759.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=79bpback to top |