prot_C-tenellus_contig11792.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig11792.1.1 vs. uniprot
Match: D7FMD2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMD2_ECTSI) HSP 1 Score: 63.5 bits (153), Expect = 7.510e-10 Identity = 35/75 (46.67%), Postives = 53/75 (70.67%), Query Frame = 0 Query: 2 EVDTLRQEVANWKKRVTSLTLSFNAVDPEEHKQVKAEKQQLV-------ETVSSMENKAAEAEKERKMLERDRDN 69 E ++LR+EV NWKKRVTSLT SFNAVDP++H+ V AEK++L +T +++EN A+ + + E++RD+ Sbjct: 181 EKESLRKEVENWKKRVTSLTASFNAVDPKDHEDVIAEKERLAKALAEADQTKAALENAKADLTRGKAAAEKERDD 255
BLAST of mRNA_C-tenellus_contig11792.1.1 vs. uniprot
Match: A0A6H5KRL3_9PHAE (TPR_MLP1_2 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KRL3_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 6.240e-8 Identity = 29/56 (51.79%), Postives = 42/56 (75.00%), Query Frame = 0 Query: 2 EVDTLRQEVANWKKRVTSLTLSFNAVDPEEHKQVKAEKQQLVETVSSMENKAAEAE 57 E ++LR+EV +WKKRVT+LT SFNAVDP++H+ V AEK++L + ++ E A E Sbjct: 883 EKESLRKEVESWKKRVTNLTASFNAVDPKDHEDVIAEKERLAKALAEAEQAKAALE 938 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig11792.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig11792.1.1 ID=prot_C-tenellus_contig11792.1.1|Name=mRNA_C-tenellus_contig11792.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=85bpback to top |