prot_C-tenellus_contig11189.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig11189.1.1 vs. uniprot
Match: A0A6H5JCY4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCY4_9PHAE) HSP 1 Score: 52.4 bits (124), Expect = 2.540e-6 Identity = 22/61 (36.07%), Postives = 36/61 (59.02%), Query Frame = 0 Query: 1 IKQINKNICRCPDGPGMFATSGAGNTLTVWDVCEQRIPLSVSAVEDKKTTNTGIALRWAPG 61 ++ + ++ CP P +FAT+GAG+ LTVWD + PL V+ ++ + T + RW PG Sbjct: 891 VQAVVHDVAWCPTSPNLFATTGAGHILTVWDTSDVFEPLCSIPVKTQRCSGTSV--RWGPG 949
BLAST of mRNA_C-tenellus_contig11189.1.1 vs. uniprot
Match: D8LDG0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDG0_ECTSI) HSP 1 Score: 52.0 bits (123), Expect = 3.480e-6 Identity = 22/61 (36.07%), Postives = 36/61 (59.02%), Query Frame = 0 Query: 1 IKQINKNICRCPDGPGMFATSGAGNTLTVWDVCEQRIPLSVSAVEDKKTTNTGIALRWAPG 61 ++ + ++ CP P +FAT+GAG+ LTVWD + PL V+ ++ + T + RW PG Sbjct: 1276 VQAVVNDVAWCPTSPNLFATTGAGHILTVWDTSDVFEPLCSIPVKTQRCSGTTV--RWGPG 1334 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig11189.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig11189.1.1 ID=prot_C-tenellus_contig11189.1.1|Name=mRNA_C-tenellus_contig11189.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=61bpback to top |