prot_C-tenellus_contig11044.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig11044.1.1 vs. uniprot
Match: D7FS79_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FS79_ECTSI) HSP 1 Score: 84.3 bits (207), Expect = 1.290e-18 Identity = 35/54 (64.81%), Postives = 45/54 (83.33%), Query Frame = 0 Query: 1 KVPLGDILDVERSGSVVWLKCLHLGTVGFEANLPGDSEIFYYAMDALLDLRCSL 54 ++PL D+LDVER G VVW+KCLHLGT+GFEA+L D+ +FY AMD+LLD RC + Sbjct: 160 QIPLRDVLDVERRGKVVWVKCLHLGTIGFEASLETDAVVFYLAMDSLLDTRCGV 213
BLAST of mRNA_C-tenellus_contig11044.1.1 vs. uniprot
Match: A0A6H5K6H5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6H5_9PHAE) HSP 1 Score: 84.3 bits (207), Expect = 9.200e-18 Identity = 35/54 (64.81%), Postives = 45/54 (83.33%), Query Frame = 0 Query: 1 KVPLGDILDVERSGSVVWLKCLHLGTVGFEANLPGDSEIFYYAMDALLDLRCSL 54 ++PL D+LDVER G VVW+KCLHLGT+GFEA+L D+ +FY AMD+LLD RC + Sbjct: 385 QIPLRDVLDVERRGKVVWVKCLHLGTIGFEASLETDAVVFYLAMDSLLDTRCGV 438
BLAST of mRNA_C-tenellus_contig11044.1.1 vs. uniprot
Match: A0A835ZK67_9STRA (SKA2 domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZK67_9STRA) HSP 1 Score: 68.9 bits (167), Expect = 2.640e-12 Identity = 31/50 (62.00%), Postives = 37/50 (74.00%), Query Frame = 0 Query: 2 VPLGDILDVERSGSVVWLKCLHLGTVGFEANLPGDSEIFYYAMDALLDLR 51 VPL D+LDVER GS+VW+K LH+G G E L D+E+ Y AMDALLD R Sbjct: 382 VPLSDVLDVEREGSIVWVKTLHMGEFGLEMPLQEDAELVYLAMDALLDER 431 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig11044.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig11044.1.1 ID=prot_C-tenellus_contig11044.1.1|Name=mRNA_C-tenellus_contig11044.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=54bpback to top |