prot_C-tenellus_contig10804.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10804.1.1 vs. uniprot
Match: A0A835YW26_9STRA (WW domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YW26_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 3.820e-10 Identity = 26/44 (59.09%), Postives = 32/44 (72.73%), Query Frame = 0 Query: 6 LTPEDYILPEGWIVAFSKKEKRSYFFNTTTGVSVWTAPSGSKPK 49 L P D++LP GW V S K++R YFFN+TTG S+WT P GS PK Sbjct: 1267 LQPHDFVLPPGWTVQRSSKQQREYFFNSTTGKSLWTPPPGSVPK 1310
BLAST of mRNA_C-tenellus_contig10804.1.1 vs. uniprot
Match: A0A6H5K9W2_9PHAE (WW domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K9W2_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 4.660e-9 Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 0 Query: 1 KEVKKLTPEDYILPEGWIVAFSKKEKRSYFFNTTTGVSVWTAPSGSKPKHA 51 +E K L+P DY+LP+GW+VA SK+E R YFFN + W P GS+ ++A Sbjct: 859 QEQKTLSPHDYVLPDGWMVARSKRENRDYFFNRRNNSTQWHPPEGSRRRNA 909
BLAST of mRNA_C-tenellus_contig10804.1.1 vs. uniprot
Match: D7FSB5_ECTSI (Dice1/dead/H box polypeptide, putative n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSB5_ECTSI) HSP 1 Score: 54.7 bits (130), Expect = 2.730e-7 Identity = 22/44 (50.00%), Postives = 30/44 (68.18%), Query Frame = 0 Query: 7 TPEDYILPEGWIVAFSKKEKRSYFFNTTTGVSVWTAPSGSKPKH 50 +P DYILP+GW+VA SK+E R YFFN + W P GS+ ++ Sbjct: 1226 SPHDYILPDGWMVARSKRENRDYFFNKRNNSTQWHPPEGSRRRN 1269
BLAST of mRNA_C-tenellus_contig10804.1.1 vs. uniprot
Match: A0A4D9CVW8_9STRA (WW domain-containing protein n=4 Tax=Monodopsidaceae TaxID=425072 RepID=A0A4D9CVW8_9STRA) HSP 1 Score: 50.8 bits (120), Expect = 6.270e-6 Identity = 20/31 (64.52%), Postives = 26/31 (83.87%), Query Frame = 0 Query: 15 EGWIVAFSKKEKRSYFFNTTTGVSVWTAPSG 45 EGW++A+SK+EKR Y+FN T V+VWTAP G Sbjct: 1033 EGWMLAWSKREKRLYYFNIKTNVAVWTAPPG 1063 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10804.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig10804.1.1 ID=prot_C-tenellus_contig10804.1.1|Name=mRNA_C-tenellus_contig10804.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=53bpback to top |