prot_C-tenellus_contig10701.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10701.1.1 vs. uniprot
Match: D8LMP7_ECTSI (Component of SCAR regulatory complex n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LMP7_ECTSI) HSP 1 Score: 70.9 bits (172), Expect = 1.170e-12 Identity = 34/59 (57.63%), Postives = 44/59 (74.58%), Query Frame = 0 Query: 10 KNRGKAPEQQHLADPLISILIGELDALVSIVQKYSSVVQRYYAEYLKGAHRTILGQRVQ 68 K +GK + L DP+I++LIGELD LVS + +Y+SV+QRYY EYLKGAH T L + VQ Sbjct: 188 KRQGKGLPEPILLDPVITVLIGELDVLVSSIVRYTSVIQRYYIEYLKGAHLTSLRRLVQ 246 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10701.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig10701.1.1 ID=prot_C-tenellus_contig10701.1.1|Name=mRNA_C-tenellus_contig10701.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=71bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|