mRNA_C-tenellus_contig947.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig947.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig947.2.1 >prot_C-tenellus_contig947.2.1 ID=prot_C-tenellus_contig947.2.1|Name=mRNA_C-tenellus_contig947.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=40bp MGEEAVPSCAGDSFHCCGGLQDCWWGGDTYLPQHGEQLG*back to top mRNA from alignment at C-tenellus_contig947:2418..3325- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig947.2.1 ID=mRNA_C-tenellus_contig947.2.1|Name=mRNA_C-tenellus_contig947.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=908bp|location=Sequence derived from alignment at C-tenellus_contig947:2418..3325- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig947:2418..3325- >mRNA_C-tenellus_contig947.2.1 ID=mRNA_C-tenellus_contig947.2.1|Name=mRNA_C-tenellus_contig947.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=120bp|location=Sequence derived from alignment at C-tenellus_contig947:2418..3325- (Choristocarpus tenellus KU2346)back to top |