mRNA_C-tenellus_contig6847.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig6847.1.1 vs. uniprot
Match: A0A6H5KY73_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KY73_9PHAE) HSP 1 Score: 67.4 bits (163), Expect = 9.640e-9 Identity = 26/48 (54.17%), Postives = 33/48 (68.75%), Query Frame = 1 Query: 286 GLPIECRTTPNSQGDTVCCKPFASPCESSMACCSGHCHEHYNRCTEVM 429 G +C TP S GDTVCCKPFA+PC+S ACCSG+C + RC + + Sbjct: 97 GFRTQCEKTPFSGGDTVCCKPFATPCDSDKACCSGNCDVSHTRCDDAI 144
BLAST of mRNA_C-tenellus_contig6847.1.1 vs. uniprot
Match: D7FIV4_ECTSI (NHL repeat-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIV4_ECTSI) HSP 1 Score: 67.0 bits (162), Expect = 1.240e-8 Identity = 26/48 (54.17%), Postives = 33/48 (68.75%), Query Frame = 1 Query: 286 GLPIECRTTPNSQGDTVCCKPFASPCESSMACCSGHCHEHYNRCTEVM 429 G +C TP S GDTVCCKPFA+PC+S ACCSG+C + RC + + Sbjct: 97 GFRTQCEKTPFSGGDTVCCKPFATPCDSDKACCSGNCDASHARCDDAV 144 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig6847.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig6847.1.1 >prot_C-tenellus_contig6847.1.1 ID=prot_C-tenellus_contig6847.1.1|Name=mRNA_C-tenellus_contig6847.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=194bp MACCSGHCHEHYNRCTEVMGEGTETTSHGVNTKGPTPSPTCTLLYSSGSIback to top mRNA from alignment at C-tenellus_contig6847:2008..3365- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig6847.1.1 ID=mRNA_C-tenellus_contig6847.1.1|Name=mRNA_C-tenellus_contig6847.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=1358bp|location=Sequence derived from alignment at C-tenellus_contig6847:2008..3365- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig6847:2008..3365- >mRNA_C-tenellus_contig6847.1.1 ID=mRNA_C-tenellus_contig6847.1.1|Name=mRNA_C-tenellus_contig6847.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=582bp|location=Sequence derived from alignment at C-tenellus_contig6847:2008..3365- (Choristocarpus tenellus KU2346)back to top |