mRNA_C-tenellus_contig11706.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig11706.1.1 vs. uniprot
Match: A0A6H5KUS3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUS3_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 1.670e-11 Identity = 28/45 (62.22%), Postives = 36/45 (80.00%), Query Frame = 1 Query: 22 RDSVSLFDTNTWEALLEFAVDTLDLASLQFSPDGYTLCLQDTSLE 156 RD + L+DT +WE+L EF +T+DL + FSPDG+TLCLQDTSLE Sbjct: 170 RDHLKLYDTRSWESLGEFTAETVDLTHVDFSPDGFTLCLQDTSLE 214
BLAST of mRNA_C-tenellus_contig11706.1.1 vs. uniprot
Match: D8LDM7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LDM7_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 4.230e-11 Identity = 27/45 (60.00%), Postives = 36/45 (80.00%), Query Frame = 1 Query: 22 RDSVSLFDTNTWEALLEFAVDTLDLASLQFSPDGYTLCLQDTSLE 156 RD + L+DT +WE+L EF +T+DL + FSPDG+TLCLQDTSL+ Sbjct: 162 RDHLKLYDTRSWESLGEFTAETVDLTHVDFSPDGFTLCLQDTSLD 206
BLAST of mRNA_C-tenellus_contig11706.1.1 vs. uniprot
Match: A0A068UA00_COFCA (Uncharacterized protein n=3 Tax=Coffea TaxID=13442 RepID=A0A068UA00_COFCA) HSP 1 Score: 51.2 bits (121), Expect = 4.540e-6 Identity = 23/45 (51.11%), Postives = 32/45 (71.11%), Query Frame = 1 Query: 22 RDSVSLFDTNTWEALLEFAVDTLDLASLQFSPDGYTLCLQDTSLE 156 +D V+L +TWE + FAVDTLDLA +Q+SPD + + D+SLE Sbjct: 156 KDYVNLLSCHTWEIISVFAVDTLDLADIQWSPDDSAIVIWDSSLE 200
BLAST of mRNA_C-tenellus_contig11706.1.1 vs. uniprot
Match: UPI001FB0C1C7 (WD repeat-containing protein WRAP73 n=1 Tax=Impatiens glandulifera TaxID=253017 RepID=UPI001FB0C1C7) HSP 1 Score: 50.4 bits (119), Expect = 8.490e-6 Identity = 23/45 (51.11%), Postives = 32/45 (71.11%), Query Frame = 1 Query: 22 RDSVSLFDTNTWEALLEFAVDTLDLASLQFSPDGYTLCLQDTSLE 156 +D V+L +TWE + FAVDTLDLA +Q+SPD + + D+SLE Sbjct: 156 KDYVNLISCHTWEIMGVFAVDTLDLADIQWSPDDSAIVIWDSSLE 200
BLAST of mRNA_C-tenellus_contig11706.1.1 vs. uniprot
Match: UPI000A2A84FD (WD repeat-containing protein WRAP73 n=1 Tax=Exaiptasia diaphana TaxID=2652724 RepID=UPI000A2A84FD) HSP 1 Score: 49.3 bits (116), Expect = 2.170e-5 Identity = 21/42 (50.00%), Postives = 30/42 (71.43%), Query Frame = 1 Query: 22 RDSVSLFDTNTWEALLEFAVDTLDLASLQFSPDGYTLCLQDT 147 +D VS+F ++W+ L F V+T DLASL +SPDG LC+ D+ Sbjct: 157 KDFVSIFTCDSWQLLKHFEVETKDLASLSWSPDGRVLCIWDS 198
BLAST of mRNA_C-tenellus_contig11706.1.1 vs. uniprot
Match: D8R9P9_SELML (ANAPC4_WD40 domain-containing protein n=2 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8R9P9_SELML) HSP 1 Score: 49.3 bits (116), Expect = 2.170e-5 Identity = 22/45 (48.89%), Postives = 33/45 (73.33%), Query Frame = 1 Query: 22 RDSVSLFDTNTWEALLEFAVDTLDLASLQFSPDGYTLCLQDTSLE 156 +D V L +N+WE + FAVDT+DLA L++SP+ T+ + D+SLE Sbjct: 156 KDYVHLLASNSWEGMGTFAVDTVDLADLEWSPNDNTIAVWDSSLE 200
BLAST of mRNA_C-tenellus_contig11706.1.1 vs. uniprot
Match: A0A7R9SXU5_9CHLO (Hypothetical protein n=1 Tax=Pycnococcus provasolii TaxID=41880 RepID=A0A7R9SXU5_9CHLO) HSP 1 Score: 48.5 bits (114), Expect = 3.940e-5 Identity = 21/45 (46.67%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 22 RDSVSLFDTNTWEALLEFAVDTLDLASLQFSPDGYTLCLQDTSLE 156 +D V++F TWE + FAV T+DLASL +SPDG + + D +L+ Sbjct: 7 KDYVTVFSVATWEPIKHFAVSTVDLASLHWSPDGSAIAICDHALD 51
BLAST of mRNA_C-tenellus_contig11706.1.1 vs. uniprot
Match: UPI000C1D6181 (WD repeat-containing protein WRAP73 n=1 Tax=Olea europaea var. sylvestris TaxID=158386 RepID=UPI000C1D6181) HSP 1 Score: 48.5 bits (114), Expect = 4.070e-5 Identity = 22/45 (48.89%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 22 RDSVSLFDTNTWEALLEFAVDTLDLASLQFSPDGYTLCLQDTSLE 156 +D V+L +TWE + FAVDTLDLA +Q+SPD + + D+ LE Sbjct: 156 KDYVNLLSCHTWEIMGVFAVDTLDLADIQWSPDDSAIVIWDSPLE 200
BLAST of mRNA_C-tenellus_contig11706.1.1 vs. uniprot
Match: UPI00125D9E3C (WD repeat-containing protein WRAP73 n=2 Tax=Ipomoea TaxID=4119 RepID=UPI00125D9E3C) HSP 1 Score: 48.5 bits (114), Expect = 4.070e-5 Identity = 22/45 (48.89%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 22 RDSVSLFDTNTWEALLEFAVDTLDLASLQFSPDGYTLCLQDTSLE 156 +D V+L +TWE + FAVDTLDLA +Q+SPD + + D+ LE Sbjct: 156 KDYVNLLSCHTWEIMGVFAVDTLDLADIQWSPDDSAIVIWDSPLE 200
BLAST of mRNA_C-tenellus_contig11706.1.1 vs. uniprot
Match: A0A830HYM9_9CHLO (ANAPC4_WD40 domain-containing protein n=1 Tax=Pycnococcus provasolii TaxID=41880 RepID=A0A830HYM9_9CHLO) HSP 1 Score: 48.5 bits (114), Expect = 4.080e-5 Identity = 21/45 (46.67%), Postives = 31/45 (68.89%), Query Frame = 1 Query: 22 RDSVSLFDTNTWEALLEFAVDTLDLASLQFSPDGYTLCLQDTSLE 156 +D V++F TWE + FAV T+DLASL +SPDG + + D +L+ Sbjct: 195 KDYVTVFSVATWEPIKHFAVSTVDLASLHWSPDGSAIAICDHALD 239 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig11706.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 18
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig11706.1.1 >prot_C-tenellus_contig11706.1.1 ID=prot_C-tenellus_contig11706.1.1|Name=mRNA_C-tenellus_contig11706.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=53bp MLSVFLNRDSVSLFDTNTWEALLEFAVDTLDLASLQFSPDGYTLCLQDTSback to top mRNA from alignment at C-tenellus_contig11706:394..552+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig11706.1.1 ID=mRNA_C-tenellus_contig11706.1.1|Name=mRNA_C-tenellus_contig11706.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=159bp|location=Sequence derived from alignment at C-tenellus_contig11706:394..552+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig11706:394..552+ >mRNA_C-tenellus_contig11706.1.1 ID=mRNA_C-tenellus_contig11706.1.1|Name=mRNA_C-tenellus_contig11706.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=159bp|location=Sequence derived from alignment at C-tenellus_contig11706:394..552+ (Choristocarpus tenellus KU2346)back to top |