mRNA_C-tenellus_contig11482.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig11482.1.1 vs. uniprot
Match: D8LN86_ECTSI (Similar to DNA (Cytosine-5-)-methyltransferase (Partial) (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LN86_ECTSI) HSP 1 Score: 72.8 bits (177), Expect = 6.950e-14 Identity = 27/40 (67.50%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 4 RRCHVCKGCKAVDCQQCRFCLDMPKHGGRGSFKQPCQARR 123 RRC C C++ DC QCR+C+DMPKHGGRGS+KQPC+AR+ Sbjct: 486 RRCGECAPCRSADCGQCRYCVDMPKHGGRGSYKQPCEARK 525
BLAST of mRNA_C-tenellus_contig11482.1.1 vs. uniprot
Match: A0A7S2WD19_9STRA (Hypothetical protein (Fragment) n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WD19_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 1.700e-8 Identity = 22/41 (53.66%), Postives = 28/41 (68.29%), Query Frame = 1 Query: 1 TRRCHVCKGCKAVDCQQCRFCLDMPKHGGRGSFKQPCQARR 123 + RC C GC+A +C CRFCLDMP GG G+ KQ C+ R+ Sbjct: 80 SNRCGECAGCRAQNCGDCRFCLDMPIFGGPGNLKQGCERRQ 120
BLAST of mRNA_C-tenellus_contig11482.1.1 vs. uniprot
Match: A0A553P9S0_TIGCA (Uncharacterized protein n=1 Tax=Tigriopus californicus TaxID=6832 RepID=A0A553P9S0_TIGCA) HSP 1 Score: 50.1 bits (118), Expect = 7.130e-6 Identity = 17/38 (44.74%), Postives = 24/38 (63.16%), Query Frame = 1 Query: 10 CHVCKGCKAVDCQQCRFCLDMPKHGGRGSFKQPCQARR 123 C +C+ C + DC C +C DMP+ GG G + PCQ R+ Sbjct: 506 CKICQACISPDCGMCSYCSDMPRFGGPGRMRHPCQMRQ 543 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig11482.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig11482.1.1 >prot_C-tenellus_contig11482.1.1 ID=prot_C-tenellus_contig11482.1.1|Name=mRNA_C-tenellus_contig11482.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=42bp TRRCHVCKGCKAVDCQQCRFCLDMPKHGGRGSFKQPCQARR*back to top mRNA from alignment at C-tenellus_contig11482:1421..1546+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig11482.1.1 ID=mRNA_C-tenellus_contig11482.1.1|Name=mRNA_C-tenellus_contig11482.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=126bp|location=Sequence derived from alignment at C-tenellus_contig11482:1421..1546+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig11482:1421..1546+ >mRNA_C-tenellus_contig11482.1.1 ID=mRNA_C-tenellus_contig11482.1.1|Name=mRNA_C-tenellus_contig11482.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=126bp|location=Sequence derived from alignment at C-tenellus_contig11482:1421..1546+ (Choristocarpus tenellus KU2346)back to top |