mRNA_C-tenellus_contig11075.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig11075.1.1 vs. uniprot
Match: A0A482RP58_9ARCH (26S protease regulatory subunit n=1 Tax=archaeon TaxID=1906665 RepID=A0A482RP58_9ARCH) HSP 1 Score: 85.5 bits (210), Expect = 1.040e-20 Identity = 40/47 (85.11%), Postives = 43/47 (91.49%), Query Frame = 1 Query: 1 APITKRGDIDYESIVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 A ITKRGDIDYES+ KLA+GFNGADLRN+ TEAGLFAIR DRDYVLE Sbjct: 18 AKITKRGDIDYESVAKLAEGFNGADLRNICTEAGLFAIREDRDYVLE 64
BLAST of mRNA_C-tenellus_contig11075.1.1 vs. uniprot
Match: A0A7S2V015_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2V015_9STRA) HSP 1 Score: 91.7 bits (226), Expect = 1.110e-20 Identity = 44/47 (93.62%), Postives = 45/47 (95.74%), Query Frame = 1 Query: 1 APITKRGDIDYESIVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 APITKRGDIDYES+VKLADGFNGADLRNV TEAGLFAIR DRDYVLE Sbjct: 321 APITKRGDIDYESVVKLADGFNGADLRNVCTEAGLFAIRNDRDYVLE 367
BLAST of mRNA_C-tenellus_contig11075.1.1 vs. uniprot
Match: A0A812UMP2_SYMMI (RPT4A protein n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A812UMP2_SYMMI) HSP 1 Score: 89.4 bits (220), Expect = 1.330e-20 Identity = 42/47 (89.36%), Postives = 45/47 (95.74%), Query Frame = 1 Query: 1 APITKRGDIDYESIVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 A ITKRGDIDY+S+VKLADGFNGADLRN+ TEAGLFAIRADRDYVLE Sbjct: 176 ASITKRGDIDYDSVVKLADGFNGADLRNICTEAGLFAIRADRDYVLE 222
BLAST of mRNA_C-tenellus_contig11075.1.1 vs. uniprot
Match: D7G9F8_ECTSI (AAA domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G9F8_ECTSI) HSP 1 Score: 91.3 bits (225), Expect = 1.560e-20 Identity = 43/47 (91.49%), Postives = 46/47 (97.87%), Query Frame = 1 Query: 1 APITKRGDIDYESIVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 A ITKRG+ID+ES+VKLADGFNGADLRNVGTEAGLFAIRADRDYVLE Sbjct: 323 ASITKRGEIDFESVVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 369
BLAST of mRNA_C-tenellus_contig11075.1.1 vs. uniprot
Match: A0A7S3H6N5_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3H6N5_9STRA) HSP 1 Score: 85.9 bits (211), Expect = 3.580e-20 Identity = 40/45 (88.89%), Postives = 43/45 (95.56%), Query Frame = 1 Query: 7 ITKRGDIDYESIVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 ITKRG+IDYES+VKLADGFNGADLRN+ TEAGLFAIR DRDYVLE Sbjct: 80 ITKRGEIDYESVVKLADGFNGADLRNICTEAGLFAIREDRDYVLE 124
BLAST of mRNA_C-tenellus_contig11075.1.1 vs. uniprot
Match: A0A835YGY4_9STRA (P-loop containing nucleoside triphosphate hydrolase protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YGY4_9STRA) HSP 1 Score: 89.7 bits (221), Expect = 5.840e-20 Identity = 44/47 (93.62%), Postives = 45/47 (95.74%), Query Frame = 1 Query: 1 APITKRGDIDYESIVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 APITKRGDIDYESIVKLAD FNGADLRNV TEAGLFAIRA+RDYVLE Sbjct: 326 APITKRGDIDYESIVKLADEFNGADLRNVCTEAGLFAIRAERDYVLE 372
BLAST of mRNA_C-tenellus_contig11075.1.1 vs. uniprot
Match: A0A7S0LA79_9EUKA (Hypothetical protein n=1 Tax=Coccolithus braarudii TaxID=221442 RepID=A0A7S0LA79_9EUKA) HSP 1 Score: 85.5 bits (210), Expect = 6.180e-20 Identity = 38/47 (80.85%), Postives = 45/47 (95.74%), Query Frame = 1 Query: 1 APITKRGDIDYESIVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 APITK+G+IDYES++KLADGFN ADLRNV TEAG+FAIRA+RDYV+E Sbjct: 86 APITKKGEIDYESVIKLADGFNAADLRNVCTEAGMFAIRAERDYVIE 132
BLAST of mRNA_C-tenellus_contig11075.1.1 vs. uniprot
Match: A0A7S1H3U4_9STRA (Hypothetical protein (Fragment) n=1 Tax=Thalassionema nitzschioides TaxID=33649 RepID=A0A7S1H3U4_9STRA) HSP 1 Score: 85.1 bits (209), Expect = 7.930e-20 Identity = 39/45 (86.67%), Postives = 43/45 (95.56%), Query Frame = 1 Query: 7 ITKRGDIDYESIVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 ITKRGDIDYES+VKLADG NGAD+RN+ TEAGLFAIR+DRDYVLE Sbjct: 109 ITKRGDIDYESVVKLADGLNGADMRNICTEAGLFAIRSDRDYVLE 153
BLAST of mRNA_C-tenellus_contig11075.1.1 vs. uniprot
Match: F0YJ94_AURAN (AAA domain-containing protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YJ94_AURAN) HSP 1 Score: 89.0 bits (219), Expect = 1.200e-19 Identity = 42/46 (91.30%), Postives = 44/46 (95.65%), Query Frame = 1 Query: 4 PITKRGDIDYESIVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 PITKRG+IDYES+ KLADGFNGADLRNV TEAGLFAIRADRDYVLE Sbjct: 339 PITKRGEIDYESVCKLADGFNGADLRNVCTEAGLFAIRADRDYVLE 384
BLAST of mRNA_C-tenellus_contig11075.1.1 vs. uniprot
Match: A0A7S1B6Y1_9STRA (Hypothetical protein n=2 Tax=Corethron hystrix TaxID=216773 RepID=A0A7S1B6Y1_9STRA) HSP 1 Score: 87.4 bits (215), Expect = 4.150e-19 Identity = 42/45 (93.33%), Postives = 43/45 (95.56%), Query Frame = 1 Query: 7 ITKRGDIDYESIVKLADGFNGADLRNVGTEAGLFAIRADRDYVLE 141 ITKRGDIDYES+VKLADG NGADLRNV TEAGLFAIRADRDYVLE Sbjct: 331 ITKRGDIDYESVVKLADGLNGADLRNVCTEAGLFAIRADRDYVLE 375 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig11075.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig11075.1.1 >prot_C-tenellus_contig11075.1.1 ID=prot_C-tenellus_contig11075.1.1|Name=mRNA_C-tenellus_contig11075.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=47bp APITKRGDIDYESIVKLADGFNGADLRNVGTEAGLFAIRADRDYVLEback to top mRNA from alignment at C-tenellus_contig11075:20..806- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig11075.1.1 ID=mRNA_C-tenellus_contig11075.1.1|Name=mRNA_C-tenellus_contig11075.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=787bp|location=Sequence derived from alignment at C-tenellus_contig11075:20..806- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig11075:20..806- >mRNA_C-tenellus_contig11075.1.1 ID=mRNA_C-tenellus_contig11075.1.1|Name=mRNA_C-tenellus_contig11075.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=141bp|location=Sequence derived from alignment at C-tenellus_contig11075:20..806- (Choristocarpus tenellus KU2346)back to top |