mRNA_C-tenellus_contig10803.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10803.1.1 vs. uniprot
Match: A0A7S1V082_9STRA (Hypothetical protein n=1 Tax=Grammatophora oceanica TaxID=210454 RepID=A0A7S1V082_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 1.250e-7 Identity = 35/93 (37.63%), Postives = 54/93 (58.06%), Query Frame = 1 Query: 22 LVAMALFAISAE-AFVGSPVRVNSRTPALFSRLSMSKDQHPEIEVAEKAALEATKKFGVSSKEAQLAWDFYEEVAAQDNSVATLPPLDDSCDV 297 ++ +ALFA A F +P + + + + L ++ P+ V + AL+AT +G+ S EA++AWD EE A DNSVATLP +D+ C V Sbjct: 6 IITLALFATKATLGFTTAPAFLIKQQQVMTTALQATR---PDTAVLVEDALKATAAYGIESAEARVAWDIVEEADASDNSVATLPSMDEECSV 95 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10803.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10803.1.1 >prot_C-tenellus_contig10803.1.1 ID=prot_C-tenellus_contig10803.1.1|Name=mRNA_C-tenellus_contig10803.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=103bp MFARCVLVAMALFAISAEAFVGSPVRVNSRTPALFSRLSMSKDQHPEIEVback to top mRNA from alignment at C-tenellus_contig10803:4499..5431+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10803.1.1 ID=mRNA_C-tenellus_contig10803.1.1|Name=mRNA_C-tenellus_contig10803.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=933bp|location=Sequence derived from alignment at C-tenellus_contig10803:4499..5431+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10803:4499..5431+ >mRNA_C-tenellus_contig10803.1.1 ID=mRNA_C-tenellus_contig10803.1.1|Name=mRNA_C-tenellus_contig10803.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=309bp|location=Sequence derived from alignment at C-tenellus_contig10803:4499..5431+ (Choristocarpus tenellus KU2346)back to top |