mRNA_C-tenellus_contig10519.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10519.1.1 vs. uniprot
Match: D7FHZ2_ECTSI (C2 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHZ2_ECTSI) HSP 1 Score: 51.6 bits (122), Expect = 2.130e-6 Identity = 24/43 (55.81%), Postives = 30/43 (69.77%), Query Frame = 1 Query: 1 QETMIGHPLYVPHCARKRLLVLAELIHRQMRLEEENNKTVIDV 129 +E ++GHP+Y P ARKRLL LAELI QMR E+E V D+ Sbjct: 625 EEHLVGHPIYAPRGARKRLLALAELIRLQMRAEKEKVTAVEDI 667 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10519.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10519.1.1 >prot_C-tenellus_contig10519.1.1 ID=prot_C-tenellus_contig10519.1.1|Name=mRNA_C-tenellus_contig10519.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=40bp MIGHPLYVPHCARKRLLVLAELIHRQMRLEEENNKTVIDVback to top mRNA from alignment at C-tenellus_contig10519:410..538+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10519.1.1 ID=mRNA_C-tenellus_contig10519.1.1|Name=mRNA_C-tenellus_contig10519.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=129bp|location=Sequence derived from alignment at C-tenellus_contig10519:410..538+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10519:410..538+ >mRNA_C-tenellus_contig10519.1.1 ID=mRNA_C-tenellus_contig10519.1.1|Name=mRNA_C-tenellus_contig10519.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=120bp|location=Sequence derived from alignment at C-tenellus_contig10519:410..538+ (Choristocarpus tenellus KU2346)back to top |