mRNA_C-tenellus_contig1049.3.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig1049.3.1 vs. uniprot
Match: D8LBD0_ECTSI (WW domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LBD0_ECTSI) HSP 1 Score: 67.8 bits (164), Expect = 2.620e-9 Identity = 29/32 (90.62%), Postives = 29/32 (90.62%), Query Frame = 1 Query: 808 PPGWQAVKDKSSGDTYYWNKTTGQTTWDTPTK 903 PPGWQAV DKSSGDTYYWNK TGQTTWD PTK Sbjct: 276 PPGWQAVPDKSSGDTYYWNKATGQTTWDFPTK 307
BLAST of mRNA_C-tenellus_contig1049.3.1 vs. uniprot
Match: A0A6H5KKE1_9PHAE (WW domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKE1_9PHAE) HSP 1 Score: 67.8 bits (164), Expect = 6.380e-9 Identity = 29/32 (90.62%), Postives = 29/32 (90.62%), Query Frame = 1 Query: 808 PPGWQAVKDKSSGDTYYWNKTTGQTTWDTPTK 903 PPGWQAV DKSSGDTYYWNK TGQTTWD PTK Sbjct: 860 PPGWQAVPDKSSGDTYYWNKATGQTTWDFPTK 891
BLAST of mRNA_C-tenellus_contig1049.3.1 vs. uniprot
Match: A0A7S2MJH8_9DINO (Hypothetical protein n=1 Tax=Brandtodinium nutricula TaxID=1333877 RepID=A0A7S2MJH8_9DINO) HSP 1 Score: 53.5 bits (127), Expect = 1.150e-5 Identity = 21/35 (60.00%), Postives = 26/35 (74.29%), Query Frame = 1 Query: 796 APGLPPGWQAVKDKSSGDTYYWNKTTGQTTWDTPT 900 AP LPPGW+ V D SSG +YYWN+ T +T+W PT Sbjct: 12 APQLPPGWEQVSDPSSGQSYYWNQATSETSWSLPT 46 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig1049.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig1049.3.1 >prot_C-tenellus_contig1049.3.1 ID=prot_C-tenellus_contig1049.3.1|Name=mRNA_C-tenellus_contig1049.3.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=302bp PQREPYPPRPPTSQPSQSQQYPPPAQPPSQQPQPTQQPGAGTPYGGTQPPback to top mRNA from alignment at C-tenellus_contig1049:2674..3579+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig1049.3.1 ID=mRNA_C-tenellus_contig1049.3.1|Name=mRNA_C-tenellus_contig1049.3.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=906bp|location=Sequence derived from alignment at C-tenellus_contig1049:2674..3579+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig1049:2674..3579+ >mRNA_C-tenellus_contig1049.3.1 ID=mRNA_C-tenellus_contig1049.3.1|Name=mRNA_C-tenellus_contig1049.3.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=906bp|location=Sequence derived from alignment at C-tenellus_contig1049:2674..3579+ (Choristocarpus tenellus KU2346)back to top |