mRNA_C-tenellus_contig10410.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10410.1.1 vs. uniprot
Match: D7FPT1_ECTSI (EF-hand domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FPT1_ECTSI) HSP 1 Score: 49.3 bits (116), Expect = 1.270e-5 Identity = 21/25 (84.00%), Postives = 21/25 (84.00%), Query Frame = 1 Query: 49 QLITADSDGICKLWDLRNFSCVQTF 123 QLITAD DG CKLWDLR FSCV TF Sbjct: 347 QLITADMDGFCKLWDLRTFSCVGTF 371
BLAST of mRNA_C-tenellus_contig10410.1.1 vs. uniprot
Match: D7FPU5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FPU5_ECTSI) HSP 1 Score: 48.5 bits (114), Expect = 2.340e-5 Identity = 18/25 (72.00%), Postives = 23/25 (92.00%), Query Frame = 1 Query: 49 QLITADSDGICKLWDLRNFSCVQTF 123 +L+TAD+DG CKLWDLR FSC++TF Sbjct: 181 KLVTADADGFCKLWDLRTFSCMETF 205
BLAST of mRNA_C-tenellus_contig10410.1.1 vs. uniprot
Match: A0A7S3ZL49_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S3ZL49_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 4.470e-5 Identity = 19/26 (73.08%), Postives = 22/26 (84.62%), Query Frame = 1 Query: 46 HQLITADSDGICKLWDLRNFSCVQTF 123 H+LITAD+ G+ KLWDLR F CVQTF Sbjct: 432 HELITADTTGVLKLWDLRTFGCVQTF 457
BLAST of mRNA_C-tenellus_contig10410.1.1 vs. uniprot
Match: A0A7S3GQ56_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3GQ56_9STRA) HSP 1 Score: 47.4 bits (111), Expect = 6.110e-5 Identity = 18/26 (69.23%), Postives = 23/26 (88.46%), Query Frame = 1 Query: 46 HQLITADSDGICKLWDLRNFSCVQTF 123 H++ITAD+ G+ KLWD+RNF CVQTF Sbjct: 53 HEVITADTSGVFKLWDVRNFMCVQTF 78
BLAST of mRNA_C-tenellus_contig10410.1.1 vs. uniprot
Match: A0A7S3GL10_9EUKA (Hypothetical protein (Fragment) n=1 Tax=Palpitomonas bilix TaxID=652834 RepID=A0A7S3GL10_9EUKA) HSP 1 Score: 47.0 bits (110), Expect = 8.360e-5 Identity = 18/25 (72.00%), Postives = 23/25 (92.00%), Query Frame = 1 Query: 49 QLITADSDGICKLWDLRNFSCVQTF 123 ++ITAD+DGI KLWD+RNF C+QTF Sbjct: 472 EVITADADGIFKLWDMRNFMCIQTF 496
BLAST of mRNA_C-tenellus_contig10410.1.1 vs. uniprot
Match: A0A2R5G3N2_9STRA (Coatomer subunit beta'-1 n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5G3N2_9STRA) HSP 1 Score: 47.0 bits (110), Expect = 8.370e-5 Identity = 18/28 (64.29%), Postives = 24/28 (85.71%), Query Frame = 1 Query: 40 NMHQLITADSDGICKLWDLRNFSCVQTF 123 N ++ITAD++G K+WD+RNFSCVQTF Sbjct: 426 NTPEIITADNEGFFKIWDIRNFSCVQTF 453 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10410.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10410.1.1 >prot_C-tenellus_contig10410.1.1 ID=prot_C-tenellus_contig10410.1.1|Name=mRNA_C-tenellus_contig10410.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=41bp PEDLTVPALSTDANMHQLITADSDGICKLWDLRNFSCVQTFback to top mRNA from alignment at C-tenellus_contig10410:807..929- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10410.1.1 ID=mRNA_C-tenellus_contig10410.1.1|Name=mRNA_C-tenellus_contig10410.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=123bp|location=Sequence derived from alignment at C-tenellus_contig10410:807..929- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10410:807..929- >mRNA_C-tenellus_contig10410.1.1 ID=mRNA_C-tenellus_contig10410.1.1|Name=mRNA_C-tenellus_contig10410.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=123bp|location=Sequence derived from alignment at C-tenellus_contig10410:807..929- (Choristocarpus tenellus KU2346)back to top |