mRNA_C-tenellus_contig10138.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10138.2.1 vs. uniprot
Match: D8LN58_ECTSI (Ribonuclease P n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LN58_ECTSI) HSP 1 Score: 48.9 bits (115), Expect = 2.100e-5 Identity = 24/44 (54.55%), Postives = 31/44 (70.45%), Query Frame = 1 Query: 4 RWSKMLNKAKPSANDGRPSFFYHFAEEDQKEQLQIFVDWLHQER 135 R +KML +++ + P FY F +EDQKEQLQIFVDWLH +R Sbjct: 544 RHTKMLARSRQRQGNENP--FYSFTDEDQKEQLQIFVDWLHAQR 585 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10138.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10138.2.1 >prot_C-tenellus_contig10138.2.1 ID=prot_C-tenellus_contig10138.2.1|Name=mRNA_C-tenellus_contig10138.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=40bp MLNKAKPSANDGRPSFFYHFAEEDQKEQLQIFVDWLHQERback to top mRNA from alignment at C-tenellus_contig10138:5215..5349- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10138.2.1 ID=mRNA_C-tenellus_contig10138.2.1|Name=mRNA_C-tenellus_contig10138.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=135bp|location=Sequence derived from alignment at C-tenellus_contig10138:5215..5349- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10138:5215..5349- >mRNA_C-tenellus_contig10138.2.1 ID=mRNA_C-tenellus_contig10138.2.1|Name=mRNA_C-tenellus_contig10138.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=120bp|location=Sequence derived from alignment at C-tenellus_contig10138:5215..5349- (Choristocarpus tenellus KU2346)back to top |