mRNA_C-tenellus_contig10045.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10045.1.1 vs. uniprot
Match: A0A146HJ32_MYCCL (CCHC-type domain-containing protein (Fragment) n=1 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146HJ32_MYCCL) HSP 1 Score: 58.5 bits (140), Expect = 6.430e-7 Identity = 32/89 (35.96%), Postives = 48/89 (53.93%), Query Frame = 1 Query: 34 EREE*ILDSAASCYITHMVKSMTNYKPCIGDQRVVTANQNSFCIAGHGDLTILFPSRDNKEVEILLQNVAHVPDLGFNLFSFQAIADKG 300 E E +LDS A+ ++T + NY I + + A+Q F G GDLT++ P+ + KEV++ + NV H P LG L S I+ G Sbjct: 409 EYEPVVLDSGATQHMTPNRDLLKNYS-AIKPRAITAADQGVFHAVGSGDLTVVIPNGEGKEVKVTIHNVLHAPKLGATLLSIGKISQLG 496 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10045.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10045.1.1 >prot_C-tenellus_contig10045.1.1 ID=prot_C-tenellus_contig10045.1.1|Name=mRNA_C-tenellus_contig10045.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=144bp MVKSMTNYKPCIGDQRVVTANQNSFCIAGHGDLTILFPSRDNKEVEILLQback to top mRNA from alignment at C-tenellus_contig10045:671..1186+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10045.1.1 ID=mRNA_C-tenellus_contig10045.1.1|Name=mRNA_C-tenellus_contig10045.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=516bp|location=Sequence derived from alignment at C-tenellus_contig10045:671..1186+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10045:671..1186+ >mRNA_C-tenellus_contig10045.1.1 ID=mRNA_C-tenellus_contig10045.1.1|Name=mRNA_C-tenellus_contig10045.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=432bp|location=Sequence derived from alignment at C-tenellus_contig10045:671..1186+ (Choristocarpus tenellus KU2346)back to top |