Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig96.17054.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 1..79 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 80..103 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 104..121 |
None | No IPR available | TMHMM | TMhelix | | coord: 80..102 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-linearis_contig96.17054.1 ID=prot_C-linearis_contig96.17054.1|Name=mRNA_C-linearis_contig96.17054.1|organism=Chordaria linearis ClinC8C monoicous|type=polypeptide|length=122bp MSRPSGAQAPPRSMLQPQVKAMGMFERSRECSSLGLPFRVSLARAKKLVE SSNSPCRANIPRTSLERIAKRRLSQRYTPVIPRSLAFWMLACALLAVALY QIVDPQGTVTTPSLSLNAGGR* back to top
|