Homology
The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig9962.1.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR036397 | Ribonuclease H superfamily | GENE3D | 3.30.420.10 | | coord: 1..99 e-value: 1.9E-6 score: 29.3 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_A-nodosum_M_contig9962.1.1 ID=prot_A-nodosum_M_contig9962.1.1|Name=mRNA_A-nodosum_M_contig9962.1.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=105bp HRRIHETLVELSKNWSRRWDEYVQPALWLYRTTSDLRLPGKVTPFRLLFG RDYRTQMDATSPNPDKEGMDRLHNLIADKSINLRQAQEISKYLQHRHEQR RLRRE back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR036397 | RNaseH_sf |
|