|
Homology
The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig977.2.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR037120 | Haem peroxidase domain superfamily, animal type | GENE3D | 1.10.640.10 | Haem peroxidase domain superfamily, animal type | coord: 22..92 e-value: 1.0E-5 score: 26.1 |
IPR019791 | Haem peroxidase, animal-type | PROSITE | PS50292 | PEROXIDASE_3 | coord: 47..92 score: 11.047976 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_A-nodosum_M_contig977.2.1 ID=prot_A-nodosum_M_contig977.2.1|Name=mRNA_A-nodosum_M_contig977.2.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=92bp MARGASKEPSSSPDMWCSLTRLLRGVVTLALLLVAAVVDSPGVVTAQETY YLGFEARTYNGTNNNLDYPLWGSVNISQVRAIAAANYSDGVS back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR037120 | Haem_peroxidase_sf_animal |
IPR019791 | Haem_peroxidase_animal |
|