prot_A-nodosum_M_contig10155.2.1 (polypeptide) Ascophyllum nodosum dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig10155.2.1 vs. uniprot
Match: K5UIC4_PHACS (Uncharacterized protein n=1 Tax=Phanerochaete carnosa (strain HHB-10118-sp) TaxID=650164 RepID=K5UIC4_PHACS) HSP 1 Score: 58.5 bits (140), Expect = 1.400e-10 Identity = 29/35 (82.86%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 1 MLPGFPGSARCVQSFDDSLDSASRKTYRISLRSSS 35 MLPG PGSARCVQ FDDSL+SA TYRISLRSSS Sbjct: 1 MLPGIPGSARCVQRFDDSLNSAIHITYRISLRSSS 35
BLAST of mRNA_A-nodosum_M_contig10155.2.1 vs. uniprot
Match: A0A0E9NCQ7_SAICN (Uncharacterized protein n=1 Tax=Saitoella complicata (strain BCRC 22490 / CBS 7301 / JCM 7358 / NBRC 10748 / NRRL Y-17804) TaxID=698492 RepID=A0A0E9NCQ7_SAICN) HSP 1 Score: 56.2 bits (134), Expect = 2.520e-8 Identity = 28/35 (80.00%), Postives = 29/35 (82.86%), Query Frame = 0 Query: 1 MLPGFPGSARCVQSFDDSLDSASRKTYRISLRSSS 35 MLPG PGSA CVQ FDDSL+SA TYRISLRSSS Sbjct: 122 MLPGIPGSAMCVQRFDDSLNSAIHITYRISLRSSS 156
BLAST of mRNA_A-nodosum_M_contig10155.2.1 vs. uniprot
Match: A0A2H3J453_WOLCO (Uncharacterized protein n=1 Tax=Wolfiporia cocos (strain MD-104) TaxID=742152 RepID=A0A2H3J453_WOLCO) HSP 1 Score: 52.0 bits (123), Expect = 6.170e-8 Identity = 27/35 (77.14%), Postives = 27/35 (77.14%), Query Frame = 0 Query: 1 MLPGFPGSARCVQSFDDSLDSASRKTYRISLRSSS 35 ML G P ARCVQ FDDSLDSA TYRISLRSSS Sbjct: 1 MLLGIPRGARCVQRFDDSLDSAIHITYRISLRSSS 35
BLAST of mRNA_A-nodosum_M_contig10155.2.1 vs. uniprot
Match: R7SKF8_DICSQ (Uncharacterized protein n=1 Tax=Dichomitus squalens (strain LYAD-421) TaxID=732165 RepID=R7SKF8_DICSQ) HSP 1 Score: 51.6 bits (122), Expect = 7.460e-8 Identity = 27/35 (77.14%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 1 MLPGFPGSARCVQSFDDSLDSASRKTYRISLRSSS 35 ML G P SARCVQ FDDSL+SA TYRISLRSSS Sbjct: 1 MLLGIPRSARCVQRFDDSLNSAIHITYRISLRSSS 35
BLAST of mRNA_A-nodosum_M_contig10155.2.1 vs. uniprot
Match: A0A0P9EDQ3_RHOGW (Uncharacterized protein n=2 Tax=Basidiomycota TaxID=5204 RepID=A0A0P9EDQ3_RHOGW) HSP 1 Score: 51.6 bits (122), Expect = 8.370e-8 Identity = 27/35 (77.14%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 1 MLPGFPGSARCVQSFDDSLDSASRKTYRISLRSSS 35 ML G P SARCVQ FDDSL+SA TYRISLRSSS Sbjct: 1 MLLGIPRSARCVQRFDDSLNSAIHITYRISLRSSS 35
BLAST of mRNA_A-nodosum_M_contig10155.2.1 vs. uniprot
Match: A0A067LQX6_9AGAM (Uncharacterized protein n=1 Tax=Botryobasidium botryosum FD-172 SS1 TaxID=930990 RepID=A0A067LQX6_9AGAM) HSP 1 Score: 51.6 bits (122), Expect = 8.560e-8 Identity = 27/35 (77.14%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 1 MLPGFPGSARCVQSFDDSLDSASRKTYRISLRSSS 35 ML G P SARCVQ FDDSL+SA TYRISLRSSS Sbjct: 1 MLLGIPRSARCVQRFDDSLNSAIHITYRISLRSSS 35
BLAST of mRNA_A-nodosum_M_contig10155.2.1 vs. uniprot
Match: A0A316V2G1_9BASI (Uncharacterized protein n=1 Tax=Meira miltonrushii TaxID=1280837 RepID=A0A316V2G1_9BASI) HSP 1 Score: 51.6 bits (122), Expect = 8.560e-8 Identity = 26/35 (74.29%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 1 MLPGFPGSARCVQSFDDSLDSASRKTYRISLRSSS 35 ML G P SARCVQ FDDSL+SA TYR+SLRSSS Sbjct: 1 MLRGIPRSARCVQRFDDSLNSAIHITYRVSLRSSS 35
BLAST of mRNA_A-nodosum_M_contig10155.2.1 vs. uniprot
Match: A0A0P9GVD2_RHOGW (Uncharacterized protein n=1 Tax=Rhodotorula graminis (strain WP1) TaxID=578459 RepID=A0A0P9GVD2_RHOGW) HSP 1 Score: 51.6 bits (122), Expect = 1.030e-7 Identity = 27/35 (77.14%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 1 MLPGFPGSARCVQSFDDSLDSASRKTYRISLRSSS 35 ML G P SARCVQ FDDSL+SA TYRISLRSSS Sbjct: 1 MLLGIPRSARCVQRFDDSLNSAIHITYRISLRSSS 35
BLAST of mRNA_A-nodosum_M_contig10155.2.1 vs. uniprot
Match: A0A2X0KI11_9BASI (BZ3500_MvSof-1268-A1-R1_C047g00159 protein n=2 Tax=Microbotryum TaxID=34416 RepID=A0A2X0KI11_9BASI) HSP 1 Score: 51.2 bits (121), Expect = 1.080e-7 Identity = 26/35 (74.29%), Postives = 27/35 (77.14%), Query Frame = 0 Query: 1 MLPGFPGSARCVQSFDDSLDSASRKTYRISLRSSS 35 ML G P SARCVQ FDDSL+SA TY ISLRSSS Sbjct: 1 MLAGIPASARCVQRFDDSLNSAIHITYHISLRSSS 35
BLAST of mRNA_A-nodosum_M_contig10155.2.1 vs. uniprot
Match: A0A8K0JE16_9TREE (Uncharacterized protein n=1 Tax=Filobasidium floriforme TaxID=5210 RepID=A0A8K0JE16_9TREE) HSP 1 Score: 51.6 bits (122), Expect = 1.490e-7 Identity = 27/35 (77.14%), Postives = 28/35 (80.00%), Query Frame = 0 Query: 1 MLPGFPGSARCVQSFDDSLDSASRKTYRISLRSSS 35 ML G P SARCVQ FDDSL+SA TYRISLRSSS Sbjct: 1 MLLGIPRSARCVQRFDDSLNSAIHITYRISLRSSS 35 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig10155.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_A-nodosum_M_contig10155.2.1 ID=prot_A-nodosum_M_contig10155.2.1|Name=mRNA_A-nodosum_M_contig10155.2.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=36bpback to top |