Homology
The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig1014.8.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR011050 | Pectin lyase fold/virulence factor | SUPERFAMILY | 51126 | Pectin lyase-like | coord: 43..159 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_A-nodosum_M_contig1014.8.1 ID=prot_A-nodosum_M_contig1014.8.1|Name=mRNA_A-nodosum_M_contig1014.8.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=165bp MNMTFLLQVLRFQGVDIALQLLLLLLLLPLPLLRSSPCPSTVKEMVVTNT TDANTLAEALLCEGSASFTVSWHGNVTLSRTLSVSNGSTLNVAASSDSTD DADTGAVVTSDGTLLLFEADLGSTVSLTGLTLYGGDGALRVTGGSFVEVI DCTFTKNNRTSSDLG back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR011050 | Pectin_lyase_fold/virulence |
|