mRNA_A-nodosum_M_contig10020.1.1 (mRNA) Ascophyllum nodosum dioecious
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig10020.1.1 vs. uniprot
Match: A0A6H5JK75_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JK75_9PHAE) HSP 1 Score: 67.4 bits (163), Expect = 8.710e-11 Identity = 43/88 (48.86%), Postives = 57/88 (64.77%), Query Frame = 3 Query: 66 MEGYVEGEDGADP----------------FAWRVKTRAGAGSAQT-AGLLAARSSGDAEATSPVHGAYGMAEVEDEDDLLASHMEFMQ 278 MEG+VEG+D D + R+ TRAG G+A + AG++AARSSG A+ SPVHGAYG+A E+ +DLL+SHM+FMQ Sbjct: 1 MEGFVEGDDPGDAPPPPAVTPSTAAAPGSNSKRLTTRAGTGTAASLAGMVAARSSGAADGISPVHGAYGLAIEEEVEDLLSSHMKFMQ 88
BLAST of mRNA_A-nodosum_M_contig10020.1.1 vs. uniprot
Match: D7FT00_ECTSI (Avl9 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FT00_ECTSI) HSP 1 Score: 63.9 bits (154), Expect = 1.910e-9 Identity = 36/56 (64.29%), Postives = 46/56 (82.14%), Query Frame = 3 Query: 114 RVKTRAGAGSAQT-AGLLAARSSGDAEATSPVHGAYGMAEVEDEDDLLASHMEFMQ 278 RV TRAG G+A + AG++AARSSG A+ SPVHGAYG+A E+ +DLL+SHM+FMQ Sbjct: 17 RVTTRAGTGTAASLAGMVAARSSGAADGISPVHGAYGLAIEEEVEDLLSSHMKFMQ 72 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig10020.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_A-nodosum_M_contig10020.1.1 >prot_A-nodosum_M_contig10020.1.1 ID=prot_A-nodosum_M_contig10020.1.1|Name=mRNA_A-nodosum_M_contig10020.1.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=119bp QDYFTLEGFSYKSRPSGTGSRQWRVTWRVKTVPTPSHGGLRLGQGQDRRKback to top mRNA from alignment at A-nodosum_M_contig10020:731..1984- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_A-nodosum_M_contig10020.1.1 ID=mRNA_A-nodosum_M_contig10020.1.1|Name=mRNA_A-nodosum_M_contig10020.1.1|organism=Ascophyllum nodosum dioecious|type=mRNA|length=1254bp|location=Sequence derived from alignment at A-nodosum_M_contig10020:731..1984- (Ascophyllum nodosum dioecious)back to top Coding sequence (CDS) from alignment at A-nodosum_M_contig10020:731..1984- >mRNA_A-nodosum_M_contig10020.1.1 ID=mRNA_A-nodosum_M_contig10020.1.1|Name=mRNA_A-nodosum_M_contig10020.1.1|organism=Ascophyllum nodosum dioecious|type=CDS|length=357bp|location=Sequence derived from alignment at A-nodosum_M_contig10020:731..1984- (Ascophyllum nodosum dioecious)back to top |