mRNA_A-nodosum_M_contig1001.8.1 (mRNA) Ascophyllum nodosum dioecious
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig1001.8.1 vs. uniprot
Match: A0A6H5KUA0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUA0_9PHAE) HSP 1 Score: 44.7 bits (104), Expect = 9.600e-5 Identity = 20/26 (76.92%), Postives = 22/26 (84.62%), Query Frame = -1 Query: 78 NHILIGYLGSLVGRRIIGSVSVQFMP 155 NHI+IGYLGSLV + IIG V VQFMP Sbjct: 27 NHIVIGYLGSLVAQGIIGEVEVQFMP 52 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig1001.8.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_A-nodosum_M_contig1001.8.1 >prot_A-nodosum_M_contig1001.8.1 ID=prot_A-nodosum_M_contig1001.8.1|Name=mRNA_A-nodosum_M_contig1001.8.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=45bp MYILRTESSANKSGGYAYTRHELNGDAADDSTTNKGPEVADEDVIback to top mRNA from alignment at A-nodosum_M_contig1001:222450..222809+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_A-nodosum_M_contig1001.8.1 ID=mRNA_A-nodosum_M_contig1001.8.1|Name=mRNA_A-nodosum_M_contig1001.8.1|organism=Ascophyllum nodosum dioecious|type=mRNA|length=360bp|location=Sequence derived from alignment at A-nodosum_M_contig1001:222450..222809+ (Ascophyllum nodosum dioecious)back to top Coding sequence (CDS) from alignment at A-nodosum_M_contig1001:222450..222809+ >mRNA_A-nodosum_M_contig1001.8.1 ID=mRNA_A-nodosum_M_contig1001.8.1|Name=mRNA_A-nodosum_M_contig1001.8.1|organism=Ascophyllum nodosum dioecious|type=CDS|length=135bp|location=Sequence derived from alignment at A-nodosum_M_contig1001:222450..222809+ (Ascophyllum nodosum dioecious)back to top |