mRNA_A-nodosum_M_contig1001.5.1 (mRNA) Ascophyllum nodosum dioecious
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig1001.5.1 vs. uniprot
Match: A0A6H5KIQ0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIQ0_9PHAE) HSP 1 Score: 80.9 bits (198), Expect = 1.320e-16 Identity = 39/52 (75.00%), Postives = 44/52 (84.62%), Query Frame = 1 Query: 1 VDEAILSKIQQRYDSVHTRLISLYPDDPAKRAHIIRQMNLSVQLLRENGTKE 156 +D+A L KIQQRYDSVH RL +LYPDDPAKR IR+MNLSVQLLRE GTK+ Sbjct: 116 IDKATLDKIQQRYDSVHPRLEALYPDDPAKRNEYIREMNLSVQLLRERGTKD 167
BLAST of mRNA_A-nodosum_M_contig1001.5.1 vs. uniprot
Match: D7FYY8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FYY8_ECTSI) HSP 1 Score: 72.8 bits (177), Expect = 9.280e-14 Identity = 35/52 (67.31%), Postives = 44/52 (84.62%), Query Frame = 1 Query: 1 VDEAILSKIQQRYDSVHTRLISLYPDDPAKRAHIIRQMNLSVQLLRENGTKE 156 V++ L KIQQRYDSV RL +L+PDDPAKR+ I+R+MNLSV+LLRE GTK+ Sbjct: 65 VEQDTLVKIQQRYDSVVPRLEALFPDDPAKRSEIVREMNLSVELLRETGTKD 116 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig1001.5.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_A-nodosum_M_contig1001.5.1 >prot_A-nodosum_M_contig1001.5.1 ID=prot_A-nodosum_M_contig1001.5.1|Name=mRNA_A-nodosum_M_contig1001.5.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=52bp VDEAILSKIQQRYDSVHTRLISLYPDDPAKRAHIIRQMNLSVQLLRENGTback to top mRNA from alignment at A-nodosum_M_contig1001:221113..221602- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_A-nodosum_M_contig1001.5.1 ID=mRNA_A-nodosum_M_contig1001.5.1|Name=mRNA_A-nodosum_M_contig1001.5.1|organism=Ascophyllum nodosum dioecious|type=mRNA|length=490bp|location=Sequence derived from alignment at A-nodosum_M_contig1001:221113..221602- (Ascophyllum nodosum dioecious)back to top Coding sequence (CDS) from alignment at A-nodosum_M_contig1001:221113..221602- >mRNA_A-nodosum_M_contig1001.5.1 ID=mRNA_A-nodosum_M_contig1001.5.1|Name=mRNA_A-nodosum_M_contig1001.5.1|organism=Ascophyllum nodosum dioecious|type=CDS|length=156bp|location=Sequence derived from alignment at A-nodosum_M_contig1001:221113..221602- (Ascophyllum nodosum dioecious)back to top |